Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.300 8.4e-37
pancreatic ductal adenocarcinoma liver m... -2.052 3.9e-04

Gene RIF (2)

AA Sequence

MALLFARSLRLCRWGAKRLGVASTEAQRGVSFKLEEKTAHSSLALFRDDMGVKYGLVGLEPTKVALNVER      1 - 70
FREWAVVLADTAVTSGRHYWEVTVKRSQQFRIGVADVDMSRDSCIGVDDRSWVFTYAQRKWYTMLANEKA     71 - 140
PVEGIGQPEKVGLLLEYEAQKLSLVDVSQVSVVHTLQTDFRGPVVPAFALWDGELLTHSGLEVPEGL       141 - 207
//

Text Mined References (14)

PMID Year Title