Property Summary

NCBI Gene PubMed Count 30
PubMed Score 13.58
PubTator Score 10.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.600 1.1e-05
diabetes mellitus -1.100 3.8e-03
glioblastoma 1.400 3.3e-05
lung carcinoma 1.500 5.2e-19
malignant mesothelioma -4.200 8.6e-09
medulloblastoma, large-cell -1.300 2.7e-03
non-small cell lung cancer -1.132 5.2e-23
osteosarcoma -1.372 2.5e-06
ovarian cancer -1.800 1.9e-08
pituitary cancer 1.200 2.0e-06
posterior fossa group B ependymoma 1.100 1.8e-08

Synonym

Accession Q8WW43 A8K589 Q564N3 Q6UWQ1 Q9H0S0 APH-1b
Symbols PSFL
APH-1B
PRO1328
TAAV688

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (14)

AA Sequence

MTAAVFFGCAFIAFGPALALYVFTIATEPLRIIFLIAGAFFWLVSLLISSLVWFMARVIIDNKDGPTQKY      1 - 70
LLIFGAFVSVYIQEMFRFAYYKLLKKASEGLKSINPGETAPSMRLLAYVSGLGFGIMSGVFSFVNTLSDS     71 - 140
LGPGTVGIHGDSPQFFLYSAFMTLVIILLHVFWGIVFFDGCEKKKWGILLIVLLTHLLVSAQTFISSYYG    141 - 210
INLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR                           211 - 257
//

Text Mined References (31)

PMID Year Title