Property Summary

NCBI Gene PubMed Count 41
Grant Count 76
R01 Count 53
Funding $7,691,582.83
PubMed Score 57.45
PubTator Score 43.13

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WW38 Q32MA6 Q9NPL7 Q9NPS4 Q9UNI5
Symbols DIH3
FOG2
SRXY9
ZNF89B
hFOG-2
ZC2HC11B

Gene

Gene RIF (22)

PMID Text
26207917 ZFPM2 is a glioma susceptibility gene, its genotype and expression showing associations with incidence and severity. The balancing selection acting on ZFPM2 may relate to its roles in multiple organ development or associated disease etiology.
25025186 screened a larger CTD population, which comprised 145 tetralogy of Fallot (TOF), 37 double-outlet ventricle outflow (DORV), and 18 transposition of the great artery (TGA), to investigate exon mutations as well as copy number variations in ZFPM2/FOG2
24769157 Findings indicate that zinc finger protein, multitype 2 protein (ZFPM2) plays a role in diaphragm and cardiovascular development.
24743694 Art27 interacts with GATA4, FOG2 and NKX2.5 and is a novel co-repressor of cardiac genes.
24702427 Isolated congenital diaphragmatic hernia was the predominant phenotype observed in our ZFPM2 mutation patients.
24549039 Whole exome sequencing identified independent missense mutations in FOG2 in two patients with 46,XY gonadal dysgenesis.
24469719 our results provide strong evidence regarding the susceptibility of the ZFPM2 gene to the development of non-syndromic TOF/DORV.
24179092 FOG1, FOG2 and GATA-6 modulate the transcriptional up-regulation of HAMP in hepatocytes during inflammation.
23029311 Sex Cord Stromal Tumors in childhood exhibited an embryonal gonadal phenotype, expressing a FOG-2/GATA-4 pattern in keeping with embryonal gonads.
21947317 association of the ZFPM2 SNP, rs12678719, with antipsychotic-induced parkinsonism
More...

AA Sequence

MSRRKQSKPRQIKRPLEDAIEDEEEECPSEETDIISKGDFPLEESFSTEFGPENLSCEEVEYFCNKGDDE      1 - 70
GIQETAESDGDTQSEKPGQPGVETDDWDGPGELEVFQKDGERKIQSRQQLPVGTTWGPFPGKMDLNNNSL     71 - 140
KTKAQVPMVLTAGPKWLLDVTWQGVEDNKNNCIVYSKGGQLWCTTTKAISEGEELIAFVVDFDSRLQAAS    141 - 210
QMTLTEGMYPARLLDSIQLLPQQAAMASILPTAIVNKDIFPCKSCGIWYRSERNLQAHLMYYCSGRQREA    211 - 280
APVSEENEDSAHQISSLCPFPQCTKSFSNARALEMHLNSHSGVKMEEFLPPGASLKCTVCSYTADSVINF    281 - 350
HQHLFSHLTQAAFRCNHCHFGFQTQRELLQHQELHVPSGKLPRESDMEHSPSATEDSLQPATDLLTRSEL    351 - 420
PQSQKAMQTKDASSDTELDKCEKKTQLFLTNQRPEIQPTTNKQSFSYTKIKSEPSSPRLASSPVQPNIGP    421 - 490
SFPVGPFLSQFSFPQDITMVPQASEILAKMSELVHRRLRHGSSSYPPVIYSPLMPKGATCFECNITFNNL    491 - 560
DNYLVHKKHYCSSRWQQMAKSPEFPSVSEKMPEALSPNTGQTSINLLNPAAHSADPENPLLQTSCINSST    561 - 630
VLDLIGPNGKGHDKDFSTQTKKLSTSSNNDDKINGKPVDVKNPSVPLVDGESDPNKTTCEACNITFSRHE    631 - 700
TYMVHKQYYCATRHDPPLKRSASNKVPAMQRTMRTRKRRKMYEMCLPEQEQRPPLVQQRFLDVANLNNPC    701 - 770
TSTQEPTEGLGECYHPRCDIFPGIVSKHLETSLTINKCVPVSKCDTTHSSVSCLEMDVPIDLSKKCLSQS    771 - 840
ERTTTSPKRLLDYHECTVCKISFNKVENYLAHKQNFCPVTAHQRNDLGQLDGKVFPNPESERNSPDVSYE    841 - 910
RSIIKCEKNGNLKQPSPNGNLFSSHLATLQGLKVFSEAAQLIATKEENRHLFLPQCLYPGAIKKAKGADQ    911 - 980
LSPYYGIKPSDYISGSLVIHNTDIEQSRNAENESPKGQASSNGCAALKKDSLPLLPKNRGMVIVNGGLKQ    981 - 1050
DERPAANPQQENISQNPQHEDDHKSPSWISENPLAANENVSPGIPSAEEQLSSIAKGVNGSSQAPTSGKY   1051 - 1120
CRLCDIQFNNLSNFITHKKFYCSSHAAEHVK                                          1121 - 1151
//

Text Mined References (43)

PMID Year Title
26207917 2015 Glioma Association and Balancing Selection of ZFPM2.
25025186 2014 Novel missense variants of ZFPM2/FOG2 identified in conotruncal heart defect patients do not impair interaction with GATA4.
24769157 Exome sequencing identifies ZFPM2 as a cause of familial isolated congenital diaphragmatic hernia and possibly cardiovascular malformations.
24743694 2014 Art27 interacts with GATA4, FOG2 and NKX2.5 and is a novel co-repressor of cardiac genes.
24702427 2015 Prevalence and penetrance of ZFPM2 mutations and deletions causing congenital diaphragmatic hernia.
24549039 2014 Mutations in the FOG2/ZFPM2 gene are associated with anomalies of human testis determination.
24469719 2014 Identification of novel significant variants of ZFPM2/FOG2 in non-syndromic Tetralogy of Fallot and double outlet right ventricle in a Chinese Han population.
24179092 2013 Friend of GATA and GATA-6 modulate the transcriptional up-regulation of hepcidin in hepatocytes during inflammation.
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
More...