Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.23
PubTator Score 1.89

Knowledge Summary

Patent

No data available

Synonym

Accession Q8WW36
Symbols CNBP2
ZNF9L

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

AA Sequence

MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNICYNC      1 - 70
GRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGHIQKDCAQVKCYRCGEIGHVA     71 - 140
INCSKARPGQLLPLRQIPTSSQGMSQ                                                141 - 166
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18312684 2008 A software application for comparing large numbers of high resolution MALDI-FTICR MS spectra demonstrated by searching candidate biomarkers for glioma blood vessel formation.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15961456 2005 Identification of nine human-specific frameshift mutations by comparative analysis of the human and the chimpanzee genome sequences.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12045143 2002 Comparative sequence analysis of the X-inactivation center region in mouse, human, and bovine.