Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.33
PubTator Score 3.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma 1.600 0.000
breast carcinoma 1.600 0.000
cystic fibrosis 1.200 0.002
invasive ductal carcinoma 1.100 0.006

Gene RIF (2)

PMID Text
26044572 integral component of the evolutionarily conserved retrograde intraflagellar transport machinery
25830415 Tctex1d2 is a novel dynein light chain important for trafficking to the cilium and potentially retrograde intraflagellar transport.

AA Sequence

MATSIGVSFSVGDGVPEAEKNAGEPENTYILRPVFQQRFRPSVVKDCIHAVLKEELANAEYSPEEMPQLT      1 - 70
KHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDADTDNYTHDVFMNDSLFCVVAAFGCF     71 - 140
YY                                                                        141 - 142
//

Text Mined References (9)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26044572 2015 TCTEX1D2 mutations underlie Jeune asphyxiating thoracic dystrophy with impaired retrograde intraflagellar transport.
25830415 2015 Tctex1d2 associates with short-rib polydactyly syndrome proteins and is required for ciliogenesis.
25205765 2014 Subunit composition of the human cytoplasmic dynein-2 complex.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.