Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.33
PubTator Score 3.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.600 2.5e-04
cystic fibrosis 1.200 1.9e-03
ependymoma 1.100 5.0e-08
invasive ductal carcinoma 1.100 6.3e-03

Synonym

Accession Q8WW35 A6NCN5
Symbols SRTD17

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MATSIGVSFSVGDGVPEAEKNAGEPENTYILRPVFQQRFRPSVVKDCIHAVLKEELANAEYSPEEMPQLT      1 - 70
KHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDADTDNYTHDVFMNDSLFCVVAAFGCF     71 - 140
YY                                                                        141 - 142
//

Text Mined References (11)

PMID Year Title