Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.96
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 5.6e-08
ovarian cancer 8520 2.0e-03
non-small cell lung cancer 2890 6.5e-03
Disease Target Count Z-score Confidence
Dendritic cell sarcoma 2 3.25 1.6
Mycosis fungoides 29 3.148 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
non-small cell lung cancer 1.000 6.5e-03
osteosarcoma -3.174 5.6e-08
ovarian cancer 1.400 2.0e-03

Gene RIF (2)

AA Sequence

MEETYTDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISS      1 - 70
CDDRSCIEQDVVNQTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFVWGTTHYSDNNSPASNIVTEH     71 - 140
KNNLASGMRVPKSLPYVLPWKNNGNAQ                                               141 - 167
//

Text Mined References (8)

PMID Year Title