Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.64
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -3.174 0.000
non-small cell lung cancer 1.000 0.007
ovarian cancer 1.400 0.002

Gene RIF (1)

PMID Text
24850846 SYCP1, cTAGE1, and GTSF1 are expressed in cutaneous T-cell lymphoma, but not in normal skin or benign inflammatory dermatoses.

AA Sequence

MEETYTDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISS      1 - 70
CDDRSCIEQDVVNQTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFVWGTTHYSDNNSPASNIVTEH     71 - 140
KNNLASGMRVPKSLPYVLPWKNNGNAQ                                               141 - 167
//

Text Mined References (7)

PMID Year Title
24850846 2014 Ectopic expression of cancer-testis antigens in cutaneous T-cell lymphoma patients.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
18703587 2008 A novel CHHC Zn-finger domain found in spliceosomal proteins and tRNA modifying enzymes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.