Property Summary

NCBI Gene PubMed Count 8
PubMed Score 11.64
PubTator Score 2.83

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
20970119 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MGKEIQLKPKANVSSYVHFLLNYRNKFKEQQPNTYVGFKEFSRKCSEKWRSISKHEKAKYEALAKLDKAR      1 - 70
YQEEMMNYVGKRKKRRKRDPQEPRRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKH     71 - 140
PYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRGKRVRQS                            141 - 186
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20970119 2011 Convergent animal and human evidence suggests a role of PPM1A gene in response to antidepressants.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15197164 2004 A transcript finishing initiative for closing gaps in the human transcriptome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.