Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.50
PubTator Score 2.83

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MGKEIQLKPKANVSSYVHFLLNYRNKFKEQQPNTYVGFKEFSRKCSEKWRSISKHEKAKYEALAKLDKAR      1 - 70
YQEEMMNYVGKRKKRRKRDPQEPRRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKH     71 - 140
PYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRGKRVRQS                            141 - 186
//

Text Mined References (10)

PMID Year Title