Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.24
PubTator Score 1.80

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.300 9.8e-04
atypical teratoid / rhabdoid tumor 1.200 6.0e-03
lung adenocarcinoma -1.300 3.9e-06
lung carcinoma -1.300 4.5e-03
medulloblastoma, large-cell 1.800 8.1e-06
ovarian cancer 1.200 1.0e-09
posterior fossa group B ependymoma 1.300 1.8e-04

Gene RIF (3)

AA Sequence

MEPIYEEYLANHGTIVKPYYWLSFSLDCSNCPYHIRTGEEARVSLTEFCQIFGFPYGTTFPQTKHLTFYE      1 - 70
LKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIILYSNNSPCNEANHCCISKMYN     71 - 140
FLITYPGITLSIYFSQLYHTEMDFPASAWNREALRSLASLWPRVVLSPISGGIWHSVLHSFISGVSGSHV    141 - 210
FQPILTGRALADRHNAYEINAITGVKPYFTDVLLQTKRNPNTKAQEALESYPLNNAFPGQFFQMPSGQLQ    211 - 280
PNLPPDLRAPVVFVLVPLRDLPPMHMGQNPNKPRNIVRHLNMPQMSFQETKDLGRLPTGRSVEIVEITEQ    281 - 350
FASSKEADEKKKKKGKK                                                         351 - 367
//

Text Mined References (8)

PMID Year Title