Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.05
PubTator Score 5.01

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
24823476 TEKT4 germline variations in a high cis linkage are biologically relevant, as ectopic expression of variant TEKT4 deregulates microtubule stability, antagonizes paclitaxel-induced stabilizing effect of microtubules and increases paclitaxel resistance.
22774605 The expression of TEKT4 is significantly decreased in the ejaculated sperm of idiopathic asthenozoospermia patients.

AA Sequence

MAQTVPPCELPCKEYDVARNTGAYTSSGLATASFRTSKYLLEEWFQNCYARYHQAFADRDQSERQRHESQ      1 - 70
QLATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLAQKQRLERALDATEVPFSIT     71 - 140
TDNLQCRERREHPNLVRDHVETELLKEAELIRNIQELLKRTIMQAVSQIRLNREHKETCEMDWSDKMEAY    141 - 210
NIDETCGRHHSQSTEVQAHPYSTTFQESASTPETRAKFTQDNLCRAQRERLASANLRVLVDCILRDTSED    211 - 280
LRLQCDAVNLAFGRRCEELEDARYKLHHHLHKTLREITDQEHNVAALKQAIKDKEAPLHVAQTRLYLRSH    281 - 350
RPNMELCRDAAQFRLLSEVEELNMSLTALREKLLEAEQSLRNLEDIHMSLEKDIAAMTNSLFIDRQKCMA    351 - 420
HRTRYPTILQLAGYQ                                                           421 - 435
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24823476 2014 Enriched variations in TEKT4 and breast cancer resistance to paclitaxel.
22774605 2012 [Expression of TEKT4 protein decreases in the ejaculated spermatozoa of idiopathic asthenozoospermic men].
21630459 2011 Proteomic characterization of the human sperm nucleus.
21516116 2011 Next-generation sequencing to generate interactome datasets.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...