Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.67
PubTator Score 1.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma -1.800 2.4e-03
astrocytic glioma -1.800 4.9e-03
Astrocytoma, Pilocytic -1.300 1.4e-04
atypical teratoid / rhabdoid tumor -1.800 5.7e-09
chronic rhinosinusitis -1.592 4.8e-02
ependymoma -1.200 6.5e-06
fascioscapulohumeral muscular dystrophy 1.122 2.4e-04
glioblastoma -1.300 2.6e-04
group 3 medulloblastoma -1.600 3.4e-02
hereditary spastic paraplegia -1.091 3.2e-02
inflammatory breast cancer 1.100 3.3e-03
interstitial cystitis -2.200 7.3e-04
intraductal papillary-mucinous adenoma (... 1.100 7.3e-03
intraductal papillary-mucinous neoplasm ... 1.400 2.2e-03
invasive ductal carcinoma 1.700 3.7e-02
juvenile dermatomyositis 1.184 6.9e-06
lung cancer -1.500 4.5e-04
medulloblastoma, large-cell -1.300 3.0e-03
nasopharyngeal carcinoma -1.400 2.6e-07
oligodendroglioma -2.300 8.9e-20
osteosarcoma -2.256 6.3e-04
pancreatic cancer 1.100 4.0e-05
Pick disease -1.100 2.7e-02
primitive neuroectodermal tumor -1.700 2.3e-02
psoriasis 1.700 2.7e-04
subependymal giant cell astrocytoma -1.681 4.5e-02

AA Sequence

MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEKFKLISQAYEVLSDPKKRDVYDQGGEQ      1 - 70
AIKEGGSGSPSFSSPMDIFDMFFGGGGRMARERRGKNVVHQLSVTLEDLYNGVTKKLALQKNVICEKCEG     71 - 140
VGGKKGSVEKCPLCKGRGMQIHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCESCSGAKVIREKKIIE    141 - 210
VHVEKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKDHSVFQRRGHDLIMKMKIQLSEALCGFKKTIKT    211 - 280
LDNRILVITSKAGEVIKHGDLRCVRDEGMPIYKAPLEKGILIIQFLVIFPEKHWLSLEKLPQLEALLPPR    281 - 350
QKVRITDDMDQVELKEFCPNEQNWRQHREAYEEDEDGPQAGVQCQTA                           351 - 397
//

Text Mined References (12)

PMID Year Title