Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.67
PubTator Score 1.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
oligodendroglioma 2849 8.93090300797853E-20
atypical teratoid / rhabdoid tumor 4369 1.28731270686371E-14
pilocytic astrocytoma 3086 8.59279143749224E-9
sonic hedgehog group medulloblastoma 1482 1.00836745164226E-8
nasopharyngeal carcinoma 1056 3.9898879626153E-8
adult high grade glioma 2148 3.34563995582839E-7
posterior fossa group A ependymoma 1511 7.55595074049315E-7
glioblastoma 5572 3.22367667396758E-6
juvenile dermatomyositis 1189 6.85695434134636E-6
medulloblastoma, large-cell 6234 1.84961138485813E-5
pancreatic cancer 2300 4.00011304729609E-5
interstitial cystitis 2299 4.09229367638302E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.07256593561142E-4
fascioscapulohumeral muscular dystrophy 100 2.41984890924918E-4
psoriasis 6685 2.70646113460083E-4
lung cancer 4473 4.50742097672652E-4
osteosarcoma 7933 6.34095640204823E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00130444718885227
astrocytic glioma 2241 0.00222511739033002
inflammatory breast cancer 404 0.00330446402872336
primitive neuroectodermal tumor 3031 0.00579825412169615
Pick disease 1893 0.026724989836424
chronic rhinosinusitis 512 0.0274202937687596
hereditary spastic paraplegia 313 0.0323750476159252
invasive ductal carcinoma 2950 0.0372833940265722
subependymal giant cell astrocytoma 2287 0.0453068527621346

Expression

Synonym

Accession Q8WW22 E9PDM9 Q6AW87 Q8N5Z4 Q8N7P2
Symbols MST104
MSTP104
PRO1472

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Pathway (1)

AA Sequence

MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEKFKLISQAYEVLSDPKKRDVYDQGGEQ      1 - 70
AIKEGGSGSPSFSSPMDIFDMFFGGGGRMARERRGKNVVHQLSVTLEDLYNGVTKKLALQKNVICEKCEG     71 - 140
VGGKKGSVEKCPLCKGRGMQIHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCESCSGAKVIREKKIIE    141 - 210
VHVEKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKDHSVFQRRGHDLIMKMKIQLSEALCGFKKTIKT    211 - 280
LDNRILVITSKAGEVIKHGDLRCVRDEGMPIYKAPLEKGILIIQFLVIFPEKHWLSLEKLPQLEALLPPR    281 - 350
QKVRITDDMDQVELKEFCPNEQNWRQHREAYEEDEDGPQAGVQCQTA                           351 - 397
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...