Property Summary

NCBI Gene PubMed Count 8
PubMed Score 18.13
PubTator Score 6.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2716 1.5e-11
osteosarcoma 7950 4.1e-07
Multiple myeloma 1332 2.2e-05
ovarian cancer 8520 9.2e-04

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.200 1.5e-11
Multiple myeloma 1.675 2.2e-05
osteosarcoma 2.519 4.1e-07
ovarian cancer -1.200 9.2e-04

Gene RIF (1)

AA Sequence

MADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKISK      1 - 70
FGFAIGSQTTKKASAISIKLGSSKPKETVPTLAPKTLSVAAAFNEDEDSEPEEMPPEAKMRMKNIGRDTP     71 - 140
TSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQDN                                    141 - 178
//

Text Mined References (18)

PMID Year Title