Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.48
PubTator Score 2.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 4.9e-05
Breast cancer 1.100 7.0e-12
glioblastoma 1.200 6.0e-08
intraductal papillary-mucinous neoplasm ... 1.100 2.2e-02
medulloblastoma, large-cell 1.200 4.0e-04
osteosarcoma 1.254 3.8e-03
ovarian cancer 1.200 2.2e-06
Pick disease -1.400 2.6e-05
primitive neuroectodermal tumor 1.200 1.3e-04
progressive supranuclear palsy -1.400 8.4e-03
X-linked cerebral adrenoleukodystrophy 1.200 1.4e-02

Protein-protein Interaction (7)

Gene RIF (3)

AA Sequence

MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDL      1 - 70
MESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFT     71 - 140
LAIVESDSTIVYYKLTDGFMLPDPQNISLRR                                           141 - 171
//

Text Mined References (21)

PMID Year Title