Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.16
PubTator Score 2.44

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WW01 B4DKP0 Q9BZQ5
Symbols PCH2F
sen15
C1orf19

Gene

PDB

2GW6  

Gene RIF (2)

PMID Text
24944287 A candidate SNP associated with the tRNA-splicing protein gene TSEN15 was independently associated with the risk of atrial fibrillation.
20546612 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDL      1 - 70
MESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFT     71 - 140
LAIVESDSTIVYYKLTDGFMLPDPQNISLRR                                           141 - 171
//

Text Mined References (19)

PMID Year Title
24944287 2014 Genetic variants related to height and risk of atrial fibrillation: the cardiovascular health study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17166513 2007 Three-dimensional structure determined for a subunit of human tRNA splicing endonuclease (Sen15) reveals a novel dimeric fold.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...