Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.94
PubTator Score 1.64

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.100 2.6e-03
glioblastoma -1.700 4.2e-04
group 4 medulloblastoma 1.100 4.6e-02
hepatocellular carcinoma 1.400 4.9e-06
intraductal papillary-mucinous neoplasm ... 1.100 2.9e-02
osteosarcoma -1.314 3.6e-03
ovarian cancer -1.800 1.4e-05
pancreatic cancer 1.200 2.4e-03
pancreatic carcinoma 1.200 2.4e-03
sarcoidosis 1.100 3.7e-02

Synonym

Accession Q8WVZ9 B5TZ86 Q5T6Y7 Q8NB99 Q9H0I6
Symbols

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (3)

AA Sequence

MQSREDVPRSRRLASPRGGRRPKRISKPSVSAFFTGPEELKDTAHSAALLAQLKSFYDARLLCDVTIEVV      1 - 70
TPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAESFEVLVDYCYTGRVSLSEAN     71 - 140
VQRLYAASDMLQLEYVREACASFLARRLDLTNCTAILKFADAFDHHKLRSQAQSYIAHNFKQLSRMGSIR    141 - 210
EETLADLTLAQLLAVLRLDSLDIESERTVCHVAVQWLEAAAKERGPSAAEVFKCVRWMHFTEEDQDYLEG    211 - 280
LLTKPIVKKYCLDVIEGALQMRYGDLLYKSLVPVPNSSSSSSSSNSLVSAAENPPQRLGMCAKEMVIFFG    281 - 350
HPRDPFLCYDPYSGDIYTMPSPLTSFAHTKTVTSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLAD    351 - 420
RLLCREGMDVAYLNGYIYILGGRDPITGVKLKEVECYSVQRNQWALVAPVPHSFYSFELIVVQNYLYAVN    421 - 490
SKRMLCYDPSHNMWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNPARGEWRRISNIPLDSETHNYQ    491 - 560
IVNHDQKLLLITSTTPQWKKNRVTVYEYDTREDQWINIGTMLGLLQFDSGFICLCARVYPSCLEPGQSFI    561 - 630
TEEDDARSESSTEWDLDGFSELDSESGSSSSFSDDEVWVQVAPQRNAQDQQGSL                    631 - 684
//

Text Mined References (17)

PMID Year Title