Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.94
PubTator Score 1.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 8.28781616004051E-6
ovarian cancer 8492 1.40125363218037E-5
glioblastoma 5572 4.22986860862787E-4
hepatocellular carcinoma 550 4.30739985785501E-4
gastric cancer 436 0.00127450566558871
pancreatic cancer 2300 0.00242977098219421
pancreatic carcinoma 567 0.00242977098219422
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0285263227882359
sarcoidosis 368 0.0372593641795154
group 4 medulloblastoma 1875 0.0458518798006427

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.200 0.001
hepatocellular carcinoma 1.700 0.000
pancreatic cancer 1.200 0.002
osteosarcoma -2.093 0.000
glioblastoma -1.700 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.029
sarcoidosis 1.100 0.037
group 4 medulloblastoma 1.100 0.046
pancreatic carcinoma 1.200 0.002
ovarian cancer -1.800 0.000

Synonym

Accession Q8WVZ9 B5TZ86 Q5T6Y7 Q8NB99 Q9H0I6
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (3)

PMID Text
25684205 KBTBD6 and KBTBD7 specifically bind to GABARAP proteins.KBTBD6 and KBTBD7 form a heterodimeric CRL3 complex.
20132730 KBTBD7 proteins may act as a new transcriptional activator in mitogen-activated protein kinase (MAPK) signaling.
18187620 Knockdown of kelch repeat and BTB (POZ) domain containing 7 (KBTBD7) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MQSREDVPRSRRLASPRGGRRPKRISKPSVSAFFTGPEELKDTAHSAALLAQLKSFYDARLLCDVTIEVV      1 - 70
TPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAESFEVLVDYCYTGRVSLSEAN     71 - 140
VQRLYAASDMLQLEYVREACASFLARRLDLTNCTAILKFADAFDHHKLRSQAQSYIAHNFKQLSRMGSIR    141 - 210
EETLADLTLAQLLAVLRLDSLDIESERTVCHVAVQWLEAAAKERGPSAAEVFKCVRWMHFTEEDQDYLEG    211 - 280
LLTKPIVKKYCLDVIEGALQMRYGDLLYKSLVPVPNSSSSSSSSNSLVSAAENPPQRLGMCAKEMVIFFG    281 - 350
HPRDPFLCYDPYSGDIYTMPSPLTSFAHTKTVTSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLAD    351 - 420
RLLCREGMDVAYLNGYIYILGGRDPITGVKLKEVECYSVQRNQWALVAPVPHSFYSFELIVVQNYLYAVN    421 - 490
SKRMLCYDPSHNMWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNPARGEWRRISNIPLDSETHNYQ    491 - 560
IVNHDQKLLLITSTTPQWKKNRVTVYEYDTREDQWINIGTMLGLLQFDSGFICLCARVYPSCLEPGQSFI    561 - 630
TEEDDARSESSTEWDLDGFSELDSESGSSSSFSDDEVWVQVAPQRNAQDQQGSL                    631 - 684
//

Text Mined References (17)

PMID Year Title
27308540 2016 GABARAP proteins as scaffolds in localized TIAM1-RAC1 signaling.
25684205 2015 CUL3-KBTBD6/KBTBD7 ubiquitin ligase cooperates with GABARAP proteins to spatially restrict TIAM1-RAC1 signaling.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
20562859 2010 Network organization of the human autophagy system.
20132730 2010 KBTBD7, a novel human BTB-kelch protein, activates transcriptional activities of SRE and AP-1.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
More...