Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.94
PubTator Score 1.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.200 0.001
hepatocellular carcinoma 1.700 0.000
pancreatic cancer 1.200 0.002
osteosarcoma -2.093 0.000
glioblastoma -1.700 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.029
sarcoidosis 1.100 0.037
group 4 medulloblastoma 1.100 0.046
pancreatic carcinoma 1.200 0.002
ovarian cancer -1.800 0.000

Synonym

Accession Q8WVZ9 B5TZ86 Q5T6Y7 Q8NB99 Q9H0I6
Symbols

Gene

Gene RIF (3)

PMID Text
25684205 KBTBD6 and KBTBD7 specifically bind to GABARAP proteins.KBTBD6 and KBTBD7 form a heterodimeric CRL3 complex.
20132730 KBTBD7 proteins may act as a new transcriptional activator in mitogen-activated protein kinase (MAPK) signaling.
18187620 Knockdown of kelch repeat and BTB (POZ) domain containing 7 (KBTBD7) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MQSREDVPRSRRLASPRGGRRPKRISKPSVSAFFTGPEELKDTAHSAALLAQLKSFYDARLLCDVTIEVV      1 - 70
TPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAESFEVLVDYCYTGRVSLSEAN     71 - 140
VQRLYAASDMLQLEYVREACASFLARRLDLTNCTAILKFADAFDHHKLRSQAQSYIAHNFKQLSRMGSIR    141 - 210
EETLADLTLAQLLAVLRLDSLDIESERTVCHVAVQWLEAAAKERGPSAAEVFKCVRWMHFTEEDQDYLEG    211 - 280
LLTKPIVKKYCLDVIEGALQMRYGDLLYKSLVPVPNSSSSSSSSNSLVSAAENPPQRLGMCAKEMVIFFG    281 - 350
HPRDPFLCYDPYSGDIYTMPSPLTSFAHTKTVTSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLAD    351 - 420
RLLCREGMDVAYLNGYIYILGGRDPITGVKLKEVECYSVQRNQWALVAPVPHSFYSFELIVVQNYLYAVN    421 - 490
SKRMLCYDPSHNMWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNPARGEWRRISNIPLDSETHNYQ    491 - 560
IVNHDQKLLLITSTTPQWKKNRVTVYEYDTREDQWINIGTMLGLLQFDSGFICLCARVYPSCLEPGQSFI    561 - 630
TEEDDARSESSTEWDLDGFSELDSESGSSSSFSDDEVWVQVAPQRNAQDQQGSL                    631 - 684
//

Text Mined References (17)

PMID Year Title
27308540 2016 GABARAP proteins as scaffolds in localized TIAM1-RAC1 signaling.
25684205 2015 CUL3-KBTBD6/KBTBD7 ubiquitin ligase cooperates with GABARAP proteins to spatially restrict TIAM1-RAC1 signaling.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
20562859 2010 Network organization of the human autophagy system.
20132730 2010 KBTBD7, a novel human BTB-kelch protein, activates transcriptional activities of SRE and AP-1.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
More...