Property Summary

Ligand Count 1
NCBI Gene PubMed Count 11
PubMed Score 6.02
PubTator Score 6.83

Knowledge Summary


No data available


  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
psoriasis 6694 0.0 3.0


  Differential Expression (6)

Disease log2 FC p
autosomal dominant Emery-Dreifuss muscul... 1.196 7.6e-04
juvenile dermatomyositis 1.450 2.3e-11
osteosarcoma -1.257 3.4e-03
ovarian cancer 1.200 5.3e-05
Pick disease -1.100 1.1e-03
Rheumatoid arthritis 1.200 4.2e-02

Gene RIF (2)

AA Sequence

DKELLKLTQYLKEIAKLDDFLDLNHKYWERYLSKKQGQ                                    281 - 318

Text Mined References (15)

PMID Year Title