Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.02
PubTator Score 6.83

Knowledge Summary


No data available


  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.042
osteosarcoma -1.257 0.003
autosomal dominant Emery-Dreifuss muscul... 1.196 0.001
juvenile dermatomyositis 1.450 0.000
Pick disease -1.100 0.001
ovarian cancer 1.200 0.000


Accession Q8WVY7 D3DQJ7 Q96DK5
Symbols CPUB1



2KX3   2LGD   2M17  

Gene RIF (2)

23667555 the high-resolution solution structure of the UBL domain of human UBLCP1 and its interaction with Rpn1
21949367 UBLCP1 is a 26S proteasome phosphatase that regulates nuclear proteasome activity

AA Sequence

DKELLKLTQYLKEIAKLDDFLDLNHKYWERYLSKKQGQ                                    281 - 318

Publication (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23667555 2013 Solution structure and Rpn1 interaction of the UBL domain of human RNA polymerase II C-terminal domain phosphatase.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21949367 2011 UBLCP1 is a 26S proteasome phosphatase that regulates nuclear proteasome activity.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.