Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.02
PubTator Score 6.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 2.27232569670943E-11
ovarian cancer 8492 5.25952429018508E-5
autosomal dominant Emery-Dreifuss muscular dystrophy 499 7.58602115504362E-4
Pick disease 1893 0.00107104003772918
osteosarcoma 7933 0.00337633085428283
Rheumatoid Arthritis 1171 0.0423796029542699
Disease Target Count Z-score Confidence
psoriasis 6685 0.0 2.0

Expression

  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.042
osteosarcoma -1.257 0.003
autosomal dominant Emery-Dreifuss muscul... 1.196 0.001
juvenile dermatomyositis 1.450 0.000
Pick disease -1.100 0.001
ovarian cancer 1.200 0.000

Synonym

Accession Q8WVY7 D3DQJ7 Q96DK5
Symbols CPUB1

Gene

PDB

2KX3   2LGD   2M17  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
23667555 the high-resolution solution structure of the UBL domain of human UBLCP1 and its interaction with Rpn1
21949367 UBLCP1 is a 26S proteasome phosphatase that regulates nuclear proteasome activity

AA Sequence

MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNT      1 - 70
KIMMMGTREESLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLL     71 - 140
VLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFM    141 - 210
LDSAAMITVHTPRRGLIDVKPLGVIWGKFSEFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDK    211 - 280
DKELLKLTQYLKEIAKLDDFLDLNHKYWERYLSKKQGQ                                    281 - 318
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23667555 2013 Solution structure and Rpn1 interaction of the UBL domain of human RNA polymerase II C-terminal domain phosphatase.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21949367 2011 UBLCP1 is a 26S proteasome phosphatase that regulates nuclear proteasome activity.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...