Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy 1.247 2.6e-04
Atopic dermatitis -1.400 2.7e-05
atypical teratoid / rhabdoid tumor -1.100 2.2e-02
autosomal dominant Emery-Dreifuss muscul... 1.022 5.5e-03
breast carcinoma -1.100 5.1e-05
Duchenne muscular dystrophy 1.117 1.8e-05
inflammatory breast cancer -1.200 3.1e-03
lung adenocarcinoma -1.300 2.5e-13
medulloblastoma, large-cell -1.100 2.9e-03
ovarian cancer -1.400 1.4e-04
pancreatic cancer 1.200 7.9e-03
pancreatic ductal adenocarcinoma liver m... -2.223 1.1e-02
ulcerative colitis 1.300 8.5e-07

Gene RIF (1)

AA Sequence

MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSYWLDLWLFILFDVVVFLFVYFLP          1 - 66
//

Text Mined References (11)

PMID Year Title