Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 2.51516186381589E-13
ulcerative colitis 2087 8.54302510064008E-7
ovarian cancer 8492 1.1245376656516E-6
Duchenne muscular dystrophy 602 1.79008155775844E-5
Atopic dermatitis 944 2.71932045930523E-5
breast carcinoma 1614 5.12513590812395E-5
acute quadriplegic myopathy 1157 2.56650028641438E-4
medulloblastoma, large-cell 6234 0.00289947816697531
inflammatory breast cancer 404 0.00311824392543903
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00552288122606291
pancreatic cancer 2300 0.00791578534227008
pancreatic ductal adenocarcinoma liver metastasis 1795 0.010609079379977
atypical teratoid / rhabdoid tumor 4369 0.0223330299959969

Expression

Synonym

Accession Q8WVX3 Q6J203
Symbols HCVFTP1

Gene

  Ortholog (2)

Species Source
Chimp OMA EggNOG
Mouse EggNOG Inparanoid

Gene RIF (1)

PMID Text
20332099 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSYWLDLWLFILFDVVVFLFVYFLP          1 - 66
//

Text Mined References (10)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16174453 2005 [Screening and cloning target genes transactivated by hepatitis C virus F protein using suppression subtractive hybridization technique].
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.