Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.49
PubTator Score 10.52

Knowledge Summary


No data available


  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
psoriasis 1.200 0.003
osteosarcoma -1.941 0.000
lung cancer -1.100 0.009
interstitial cystitis 1.700 0.000
group 4 medulloblastoma 1.100 0.008
pilocytic astrocytoma 1.100 0.000
posterior fossa group B ependymoma 1.100 0.000
primary Sjogren syndrome 1.100 0.026
ovarian cancer -1.200 0.000

Gene RIF (1)

26809444 Genes encoding butyrophilin-2A2 (BTN2A2) are regulated by the class II trans-activator and regulatory factor X, two transcription factors dedicated to major histocompatibility complex class II expression, suggesting a role in T cell immunity.

AA Sequence

SPIFICPALTGASGVMVPEEGLKLHRVGTHQSL                                         491 - 523

Text Mined References (13)

PMID Year Title
26809444 2016 Btn2a2, a T cell immunomodulatory molecule coregulated with MHC class II genes.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19571809 2009 Common variants on chromosome 6p22.1 are associated with schizophrenia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12124930 2002 A proteomic approach to evaluate the butyrophilin gene family expression in human milk fat globule membrane.