Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.32
PubTator Score 10.52

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.4e-04
group 4 medulloblastoma 1.100 8.4e-03
interstitial cystitis 1.700 3.2e-04
lung cancer -1.100 8.7e-03
malignant mesothelioma -1.600 1.3e-06
osteosarcoma -1.225 2.2e-05
ovarian cancer -1.200 7.3e-07
posterior fossa group B ependymoma 1.100 1.1e-04
primary Sjogren syndrome 1.100 2.6e-02
psoriasis 1.200 2.6e-03

Gene RIF (1)

AA Sequence

MEPAAALHFSLPASLLLLLLLLLLSLCALVSAQFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRW      1 - 70
FRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEA     71 - 140
ILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTA    141 - 210
VIIRDKYVRNVSCSVNNTLLGQEKETVIFIPESFMPSASPWMVALAVILTASPWMVSMTVILAVFIIFMA    211 - 280
VSICCIKKLQREKKILSGEKKVEQEEKEIAQQLQEELRWRRTFLHAADVVLDPDTAHPELFLSEDRRSVR    281 - 350
RGPYRQRVPDNPERFDSQPCVLGWESFASGKHYWEVEVENVMVWTVGVCRHSVERKGEVLLIPQNGFWTL    351 - 420
EMFGNQYRALSSPERILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFTVPVRPFFRLGSDD    421 - 490
SPIFICPALTGASGVMVPEEGLKLHRVGTHQSL                                         491 - 523
//

Text Mined References (13)

PMID Year Title