Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.14
PubTator Score 99.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Atopic dermatitis -2.300 4.1e-04
interstitial cystitis -2.300 8.0e-03
intraductal papillary-mucinous adenoma (... 1.800 5.3e-04
intraductal papillary-mucinous carcinoma... 1.600 2.1e-03
intraductal papillary-mucinous neoplasm ... 1.200 6.5e-03
lung cancer 2.400 2.2e-04
lung carcinoma 2.100 7.8e-17
non-small cell lung cancer 1.368 7.4e-08
pancreatic cancer 1.500 1.0e-05
periodontitis -1.200 1.6e-15
psoriasis 1.100 5.4e-03
spina bifida -1.023 3.9e-02

Gene RIF (5)

AA Sequence

MSSSYWSETSSSSCGTQQLPEVLQCQPQHYHCYHQSSQAQQPPEKNVVYERVRTYSGPMNKVVQALDPFN      1 - 70
SREVLSPLKTTSSYQNLVWSDHSQELHSPTLKISTCAPSTLHITQNTEQELHSPTVKLTTYPQTTIRKYV     71 - 140
VQNPEQEPLSQFLRGSHFFPGNNVIYEKTIRKVEKLNTDQGCHPQAQCHHHIIQQPQVIHSAHWQQPDSS    141 - 210
QQIQAITGNNPISTHIGNELCHSGSSQICEQVIIQDDGPEKLDPRYFGELLADLSRKNTDLYHCLLEHLQ    211 - 280
RIGGSKQDFESTDESEDIESLIPKGLSEFTKQQIRYILQMRGMSDKSLRLVLSTFSNIREELGHLQNDMT    281 - 350
SLENDKMRLEKDLSFKDTQLKEYEELLASVRANNHQQQQGLQDSSSKCQALEENNLSLRHTLSDMEYRLK    351 - 420
ELEYCKRNLEQENQNLRMQVSETCTGPMLQAKMDEIGNHYTEMVKNLRMEKDREICRLRSQLNQYHKDVS    421 - 490
KREGSCSDFQFKLHELTSLLEEKDSLIKRQSEELSKLRQEIYSSHNQPSTGGRTTITTKKYRTQYPILGL    491 - 560
LYDDYEYIPPGSETQTIVIEKTEDKYTCP                                             561 - 589
//

Text Mined References (15)

PMID Year Title