Property Summary

NCBI Gene PubMed Count 14
Grant Count 2
Funding $19,114.24
PubMed Score 6.14
PubTator Score 99.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (5)

PMID Text
25084053 POF1B was restricted to granular layers in human healthy epidermis, whereas it largely increased in hyperproliferative human skin diseases, thus demonstrating the localization of POF1B also in desmosomes of multistratified epithelia.
21940798 The POF1B candidate gene for premature ovarian failure regulates epithelial polarity
20734064 Observational study of gene-disease association. (HuGE Navigator)
15459172 Observational study of gene-disease association. (HuGE Navigator)
15459172 Our findings could not demonstrate any involvement of POF1B in premature ovarian failure

AA Sequence

MSSSYWSETSSSSCGTQQLPEVLQCQPQHYHCYHQSSQAQQPPEKNVVYERVRTYSGPMNKVVQALDPFN      1 - 70
SREVLSPLKTTSSYQNLVWSDHSQELHSPTLKISTCAPSTLHITQNTEQELHSPTVKLTTYPQTTIRKYV     71 - 140
VQNPEQEPLSQFLRGSHFFPGNNVIYEKTIRKVEKLNTDQGCHPQAQCHHHIIQQPQVIHSAHWQQPDSS    141 - 210
QQIQAITGNNPISTHIGNELCHSGSSQICEQVIIQDDGPEKLDPRYFGELLADLSRKNTDLYHCLLEHLQ    211 - 280
RIGGSKQDFESTDESEDIESLIPKGLSEFTKQQIRYILQMRGMSDKSLRLVLSTFSNIREELGHLQNDMT    281 - 350
SLENDKMRLEKDLSFKDTQLKEYEELLASVRANNHQQQQGLQDSSSKCQALEENNLSLRHTLSDMEYRLK    351 - 420
ELEYCKRNLEQENQNLRMQVSETCTGPMLQAKMDEIGNHYTEMVKNLRMEKDREICRLRSQLNQYHKDVS    421 - 490
KREGSCSDFQFKLHELTSLLEEKDSLIKRQSEELSKLRQEIYSSHNQPSTGGRTTITTKKYRTQYPILGL    491 - 560
LYDDYEYIPPGSETQTIVIEKTEDKYTCP                                             561 - 589
//

Text Mined References (15)

PMID Year Title
25084053 2015 POF1B localizes to desmosomes and regulates cell adhesion in human intestinal and keratinocyte cell lines.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21940798 2011 The POF1B candidate gene for premature ovarian failure regulates epithelial polarity.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17123869 2007 Spatial and temporal expression of POF1B, a gene expressed in epithelia.
16773570 2006 Disruption of POF1B binding to nonmuscle actin filaments is associated with premature ovarian failure.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459172 2004 Mutation analysis of two candidate genes for premature ovarian failure, DACH2 and POF1B.
More...