Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.07
PubTator Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 5.4e-07
osteosarcoma 7950 9.0e-05
astrocytoma 1146 1.7e-03
non primary Sjogren syndrome sicca 891 3.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Cerebral amyloid angiopathy 13 3.213 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.600 1.7e-03
non primary Sjogren syndrome sicca 1.200 3.9e-02
osteosarcoma -1.658 9.0e-05
ovarian cancer 2.200 5.4e-07

Gene RIF (3)

AA Sequence

MEDAGGGEETPAPEAPHPPQLAPPEEQGLLFQEETIDLGGDEFGSEENETASEGSSPLADKLNEHMMESV      1 - 70
LISDSPNSEGDAGDLGRVRDEAEPGGEGDPGPEPAGTPSPSGEADGDCAPEDAAPSSGGAPRQDAAREVP     71 - 140
GSEAARPEQEPPVAEPVPVCTIFSQRAPPASGDGFEPQMVKSPSFGGASEASARTPPQVVQPSPSLSTFF    141 - 210
GDTAASHSLASDFFDSFTTSAFISVSNPGAGSPAPASPPPLAVPGTEGRPEPVAMRGPQAAAPPASPEPF    211 - 280
AHIQAVFAGSDDPFATALSMSEMDRRNDAWLPGEATRGVLRAVATQQRGAVFVDKENLTMPGLRFDNIQG    281 - 350
DAVKDLMLRFLGEKAAAKRQVLNADSVEQSFVGLKQLISCRNWRAAVDLCGRLLTAHGQGYGKSGLLTSH    351 - 420
TTDSLQLWFVRLALLVKLGLFQNAEMEFEPFGNLDQPDLYYEYYPHVYPGRRGSMVPFSMRILHAELQQY    421 - 490
LGNPQESLDRLHKVKTVCSKILANLEQGLAEDGGMSSVTQEGRQASIRLWRSRLGRVMYSMANCLLLMKD    491 - 560
YVLAVEAYHSVIKYYPEQEPQLLSGIGRISLQIGDIKTAEKYFQDVEKVTQKLDGLQGKIMVLMNSAFLH    561 - 630
LGQNNFAEAHRFFTEILRMDPRNAVANNNAAVCLLYLGKLKDSLRQLEAMVQQDPRHYLHESVLFNLTTM    631 - 700
YELESSRSMQKKQALLEAVAGKEGDSFNTQCLKLA                                       701 - 735
//

Text Mined References (18)

PMID Year Title