Property Summary

NCBI Gene PubMed Count 33
PubMed Score 251.04
PubTator Score 53.15

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WVP7 A4D242 Q8N3E3 Q96QZ5 Q9H5N0 Q9HAG9 Q9UDN5 Q9Y6U2
Symbols LSS
TPT
ZRS
ACHP
PPD2
THYP
DIF14
C7orf2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (12)

AA Sequence

MEGQDEVSAREQHFHSQVRESTICFLLFAILYVVSYFIITRYKRKSDEQEDEDAIVNRISLFLSTFTLAV      1 - 70
SAGAVLLLPFSIISNEILLSFPQNYYIQWLNGSLIHGLWNLASLFSNLCLFVLMPFAFFFLESEGFAGLK     71 - 140
KGIRARILETLVMLLLLALLILGIVWVASALIDNDAASMESLYDLWEFYLPYLYSCISLMGCLLLLLCTP    141 - 210
VGLSRMFTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRLNGLSSSVEYNIMELEQELENVKTLKTKLE    211 - 280
RRKKASAWERNLVYPAVMVLLLIETSISVLLVACNILCLLVDETAMPKGTRGPGIGNASLSTFGFVGAAL    281 - 350
EIILIFYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFDLLGDFG    351 - 420
RFNWLGNFYIVLSYNLLFAIVTTLCLVRKFTSAVREELFKALGLHKLHLPNTSRDSETAKPSVNGHQKAL    421 - 490
//

Text Mined References (39)

PMID Year Title