Property Summary

NCBI Gene PubMed Count 8
PubMed Score 7.59
PubTator Score 11.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.300 1.0e-02
astrocytic glioma -2.600 3.7e-03
atypical teratoid / rhabdoid tumor -1.600 4.3e-05
Breast cancer 1.400 5.8e-11
ependymoma -2.500 1.2e-02
gastric carcinoma 1.200 2.6e-02
glioblastoma -1.400 1.2e-04
group 4 medulloblastoma -2.100 4.0e-04
interstitial cystitis 1.100 7.4e-04
intraductal papillary-mucinous neoplasm ... 1.500 2.3e-02
medulloblastoma, large-cell -2.600 4.9e-05
nasopharyngeal carcinoma -1.300 7.5e-05
oligodendroglioma -2.300 1.1e-02
osteosarcoma -1.533 8.4e-04
ovarian cancer 1.100 4.3e-06
pancreatic ductal adenocarcinoma liver m... -1.126 1.5e-02
primitive neuroectodermal tumor -1.700 1.2e-03

Synonym

Accession Q8WVP5 D6W627 TIPE1
Symbols TIPE1

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MDTFSTKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKL      1 - 70
GLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVDFTFDRRVLAAGLLECRDLLHQAVGPHLTAKSH     71 - 140
GRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL                            141 - 186
//

Text Mined References (10)

PMID Year Title