Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.59
PubTator Score 9.53

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (2)

Gene RIF (7)

AA Sequence

MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIW      1 - 70
FVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEE     71 - 140
EEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLM    141 - 210
KELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPF    211 - 280
DPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLAR    281 - 350
AQQSYNSIVQIHEKNGWYTPPKEDG                                                 351 - 375
//

Text Mined References (16)

PMID Year Title