Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.59
PubTator Score 9.53

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WVN8 B7Z3Q2 H3BRG2 Q8N4G6 Q96J08
Symbols

Gene

PANTHER Protein Class (1)

PDB

1ZUO  

Gene RIF (7)

PMID Text
26745068 UBE2Q1 hypomethylation is associated with Colorectal Cancer.
22642244 The newly characterized human gene, UBE2Q2, may have implications for the pathogenesis of acute lymphoblastic leukemia.
20383146 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20193842 In the 21 breast cancer cases investigated, a high increase in UBE2Q2 expression was found in 8 breast cancers (38.1%), a moderately increased UBE2Q2 expression was observed in 7 cases (33.3%), and no sig. changes were detected in 6 cases (28.6%).
19723876 Found high expression levels of UBE2Q2 in human head and neck carcinoma cell lines and cancer tissues; found the level of UBE2Q2 is decreased in cell lines and cancer tissues that have resistance to CDDP or docetaxel.
17471241 Inhibition of the UBE2Q2 protein causes cells to undergo a prolonged prophase arrest suggesting that UBE2Q2 normally functions to antagonize an early mitotic checkpoint.
16300736 the novel LOC92912 gene is characterized. It is over-expressed in hypopharyngeal tumours. Its functions may be linked with the cytoskeleton; it may represent a new target for cancer therapeutics.

AA Sequence

MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIW      1 - 70
FVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEE     71 - 140
EEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLM    141 - 210
KELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPF    211 - 280
DPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLAR    281 - 350
AQQSYNSIVQIHEKNGWYTPPKEDG                                                 351 - 375
//

Text Mined References (15)

PMID Year Title
26745068 2015 Promoter Methylation Status of Two Novel Human Genes, UBE2Q1 and UBE2Q2, in Colorectal Cancer: a New Finding in Iranian Patients.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
22642244 2012 Expression of UBE2Q2, a putative member of the ubiquitin-conjugating enzyme family in pediatric acute lymphoblastic leukemia.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20193842 2010 Overexpression of the novel human gene, UBE2Q2, in breast cancer.
20061386 2010 The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.
19723876 2009 Ubiquitin-conjugating enzyme UBE2Q2 suppresses cell proliferation and is down-regulated in recurrent head and neck cancer.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17471241 2007 Inactivation of the ubiquitin conjugating enzyme UBE2Q2 causes a prophase arrest and enhanced apoptosis in response to microtubule inhibiting agents.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...