Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.99
PubTator Score 25.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Atopic dermatitis 1.200 2.6e-04
breast carcinoma 1.200 5.4e-03
cutaneous lupus erythematosus 1.900 1.3e-03
inflammatory breast cancer 1.800 3.1e-02
intraductal papillary-mucinous adenoma (... -1.100 3.2e-03
lung carcinoma -1.700 7.7e-17
malignant mesothelioma -3.700 1.9e-07
medulloblastoma, large-cell -1.100 8.0e-03
mucosa-associated lymphoid tissue lympho... 1.766 1.5e-02
ovarian cancer 1.200 1.4e-03
psoriasis 1.300 5.2e-03
subependymal giant cell astrocytoma 1.057 2.1e-02
tuberculosis 1.600 2.5e-05
X-linked cerebral adrenoleukodystrophy -1.500 3.3e-02

Gene RIF (6)

AA Sequence

MQTCPLAFPGHVSQALGTLLFLAASLSAQNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRA      1 - 70
HGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQS     71 - 140
APDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKVAALRAGAQQGLSRASAELW    141 - 210
TPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP                                    211 - 248
//

Text Mined References (18)

PMID Year Title