Property Summary

NCBI Gene PubMed Count 26
PubMed Score 274.60
PubTator Score 72.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
astrocytoma 1493 1.36143693805629E-21
oligodendroglioma 2849 8.55089569519359E-12
ovarian cancer 8492 5.90971701439942E-11
medulloblastoma 1524 6.36809426732353E-11
posterior fossa group A ependymoma 1511 4.18542465693345E-9
Pick disease 1893 5.20650826033063E-6
osteosarcoma 7933 1.08405658786921E-5
pediatric high grade glioma 2712 3.15361261667961E-5
glioblastoma 5572 1.09044748866885E-4
primitive neuroectodermal tumor 3031 1.28128795543771E-4
pilocytic astrocytoma 3086 1.89218759933335E-4
diabetes mellitus 1663 0.00143725470850936
medulloblastoma, large-cell 6234 0.00170383144892174
aldosterone-producing adenoma 664 0.0080666464374326
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma 1.100 0.000
glioblastoma 1.400 0.000
oligodendroglioma 1.100 0.000
osteosarcoma -1.608 0.000
posterior fossa group A ependymoma 1.500 0.000
medulloblastoma 2.000 0.000
medulloblastoma, large-cell 1.400 0.002
primitive neuroectodermal tumor 1.400 0.000
diabetes mellitus -1.200 0.001
pediatric high grade glioma 1.500 0.000
pilocytic astrocytoma 1.100 0.000
aldosterone-producing adenoma -1.275 0.008
Pick disease 1.300 0.000
ovarian cancer -1.600 0.000

Synonym

Accession Q8WVM7 O00539 Q6P275
Symbols SA1
SCC3A

Gene

  Ortholog (6)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (8)

PMID Text
24335498 Mutations in STAG1 is associated with acute myeloid leukemia.
24324008 cohesin-SA1 and cohesin-SA2 participate in the DNA damage response
23874961 Rad21 binds to SA proteins through two SA-binding motifs on Rad21.
22715410 Nuclear import and export signals of human cohesins SA1/STAG1 and SA2/STAG2 expressed in Saccharomyces cerevisiae.
19936222 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19822671 cohesin(SA1) and cohesin(SA2) are differentially required for telomere and centromere cohesion, respectively.
18550811 STAG1 (Scc3/SA1) subunit of cohesin interacts with the CCTC-binding factor CTCF bound to the c-myc insulator element.
15361841 STAG1, a novel transcriptional target for p53, mediates p53-dependent apoptosis, and might be a good candidate for next-generation gene therapy in cancer.

AA Sequence

MITSELPVLQDSTNETTAHSDAGSELEETEVKGKRKRGRPGRPPSTNKKPRKSPGEKSRIEAGIRGAGRG      1 - 70
RANGHPQQNGEGEPVTLFEVVKLGKSAMQSVVDDWIESYKQDRDIALLDLINFFIQCSGCRGTVRIEMFR     71 - 140
NMQNAEIIRKMTEEFDEDSGDYPLTMPGPQWKKFRSNFCEFIGVLIRQCQYSIIYDEYMMDTVISLLTGL    141 - 210
SDSQVRAFRHTSTLAAMKLMTALVNVALNLSIHQDNTQRQYEAERNKMIGKRANERLELLLQKRKELQEN    211 - 280
QDEIENMMNSIFKGIFVHRYRDAIAEIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTLHDRQGEVRLKC    281 - 350
LKALQSLYTNRELFPKLELFTNRFKDRIVSMTLDKEYDVAVEAIRLVTLILHGSEEALSNEDCENVYHLV    351 - 420
YSAHRPVAVAAGEFLHKKLFSRHDPQAEEALAKRRGRNSPNGNLIRMLVLFFLESELHEHAAYLVDSLWE    421 - 490
SSQELLKDWECMTELLLEEPVQGEEAMSDRQESALIELMVCTIRQAAEAHPPVGRGTGKRVLTAKERKTQ    491 - 560
IDDRNKLTEHFIITLPMLLSKYSADAEKVANLLQIPQYFDLEIYSTGRMEKHLDALLKQIKFVVEKHVES    561 - 630
DVLEACSKTYSILCSEEYTIQNRVDIARSQLIDEFVDRFNHSVEDLLQEGEEADDDDIYNVLSTLKRLTS    631 - 700
FHNAHDLTKWDLFGNCYRLLKTGIEHGAMPEQIVVQALQCSHYSILWQLVKITDGSPSKEDLLVLRKTVK    701 - 770
SFLAVCQQCLSNVNTPVKEQAFMLLCDLLMIFSHQLMTGGREGLQPLVFNPDTGLQSELLSFVMDHVFID    771 - 840
QDEENQSMEGDEEDEANKIEALHKRRNLLAAFSKLIIYDIVDMHAAADIFKHYMKYYNDYGDIIKETLSK    841 - 910
TRQIDKIQCAKTLILSLQQLFNELVQEQGPNLDRTSAHVSGIKELARRFALTFGLDQIKTREAVATLHKD    911 - 980
GIEFAFKYQNQKGQEYPPPNLAFLEVLSEFSSKLLRQDKKTVHSYLEKFLTEQMMERREDVWLPLISYRN    981 - 1050
SLVTGGEDDRMSVNSGSSSSKTSSVRNKKGRPPLHKKRVEDESLDNTWLNRTDTMIQTPGPLPAPQLTST   1051 - 1120
VLRENSRPMGDQIQEPESEHGSEPDFLHNPQMQISWLGQPKLEDLNRKDRTGMNYMKVRTGVRHAVRGLM   1121 - 1190
EEDAEPIFEDVMMSSRSQLEDMNEEFEDTMVIDLPPSRNRRERAELRPDFFDSAAIIEDDSGFGMPMF     1191 - 1258
//

Text Mined References (31)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24335498 2014 Mutations in the cohesin complex in acute myeloid leukemia: clinical and prognostic implications.
24324008 2014 Distinct functions of human cohesin-SA1 and cohesin-SA2 in double-strand break repair.
23874961 2013 Characterization of the interaction between the cohesin subunits Rad21 and SA1/2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22715410 2012 Nuclear import and export signals of human cohesins SA1/STAG1 and SA2/STAG2 expressed in Saccharomyces cerevisiae.
21269460 2011 Initial characterization of the human central proteome.
19936222 2009 Forty-three loci associated with plasma lipoprotein size, concentration, and cholesterol content in genome-wide analysis.
More...