Property Summary

NCBI Gene PubMed Count 23
Grant Count 10
R01 Count 8
Funding $784,589.93
PubMed Score 30.62
PubTator Score 21.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.151 0.000
lung cancer 1.800 0.000
subependymal giant cell astrocytoma 1.002 0.049
ovarian cancer 1.300 0.000

Gene RIF (14)

PMID Text
24916378 Loss of TFB1M results in mitochondrial dysfunction that leads to impaired insulin secretion and diabetes.
21195351 Deficiency in TFB1M and impaired mitochondrial function contribute to the pathogenesis of type 2 diabetes.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19681768 The mRNA levels of TFB1M and TFB2M are influenced by endurance training
19417006 rRNA methyltransferase activity is necessary for induction of mitochondrial biogenesis by TFB1M, but not TFB2M.
19096125 determined the variation in the TFAM, TFB1M, and TFB2M genes in cardiac hypertrophy
19096125 Observational study of gene-disease association. (HuGE Navigator)
18980857 This study suggested that DNA variants in TFB1M did not contribute to the risk for parkinson disease.
18980857 Observational study of gene-disease association. (HuGE Navigator)
17557812 Distinct, but possibly coordinated functions of mtTFB1 and mtTFB2 in mitochondrial gene expression and biogenesis.
More...

AA Sequence

MAASGKLSTCRLPPLPTIREIIKLLRLQAAKQLSQNFLLDLRLTDKIVRKAGNLTNAYVYEVGPGPGGIT      1 - 70
RSILNADVAELLVVEKDTRFIPGLQMLSDAAPGKLRIVHGDVLTFKVEKAFSESLKRPWEDDPPNVHIIG     71 - 140
NLPFSVSTPLIIKWLENISCRDGPFVYGRTQMTLTFQKEVAERLAANTGSKQRSRLSVMAQYLCNVRHIF    141 - 210
TIPGQAFVPKPEVDVGVVHFTPLIQPKIEQPFKLVEKVVQNVFQFRRKYCHRGLRMLFPEAQRLESTGRL    211 - 280
LELADIDPTLRPRQLSISHFKSLCDVYRKMCDEDPQLFAYNFREELKRRKSKNEEKEEDDAENYRL        281 - 346
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24916378 2014 Loss of TFB1M results in mitochondrial dysfunction that leads to impaired insulin secretion and diabetes.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
21195351 2011 A common variant in TFB1M is associated with reduced insulin secretion and increased future risk of type 2 diabetes.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20843780 2011 Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing.
19681768 2010 Training response of mitochondrial transcription factors in human skeletal muscle.
19417006 2009 Elucidation of separate, but collaborative functions of the rRNA methyltransferase-related human mitochondrial transcription factors B1 and B2 in mitochondrial biogenesis reveals new insight into maternally inherited deafness.
More...