Property Summary

NCBI Gene PubMed Count 24
PubMed Score 30.60
PubTator Score 21.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.800 1.3e-04
osteosarcoma -1.151 1.0e-04
ovarian cancer 1.300 6.1e-07
subependymal giant cell astrocytoma 1.002 4.9e-02

Protein-protein Interaction (2)

Gene RIF (14)

AA Sequence

MAASGKLSTCRLPPLPTIREIIKLLRLQAAKQLSQNFLLDLRLTDKIVRKAGNLTNAYVYEVGPGPGGIT      1 - 70
RSILNADVAELLVVEKDTRFIPGLQMLSDAAPGKLRIVHGDVLTFKVEKAFSESLKRPWEDDPPNVHIIG     71 - 140
NLPFSVSTPLIIKWLENISCRDGPFVYGRTQMTLTFQKEVAERLAANTGSKQRSRLSVMAQYLCNVRHIF    141 - 210
TIPGQAFVPKPEVDVGVVHFTPLIQPKIEQPFKLVEKVVQNVFQFRRKYCHRGLRMLFPEAQRLESTGRL    211 - 280
LELADIDPTLRPRQLSISHFKSLCDVYRKMCDEDPQLFAYNFREELKRRKSKNEEKEEDDAENYRL        281 - 346
//

Text Mined References (27)

PMID Year Title