Property Summary

NCBI Gene PubMed Count 10
PubMed Score 58.76
PubTator Score 38.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 3.2e-08
group 3 medulloblastoma 4104 1.0e-03
lung cancer 4740 1.3e-02
Multiple myeloma 1332 1.5e-02
Disease Target Count Z-score Confidence
Dysentery 10 3.202 1.6
Typhoid fever 22 3.012 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.0e-03
lung cancer 1.200 1.3e-02
malignant mesothelioma 2.100 3.2e-08
Multiple myeloma 1.013 1.5e-02

Gene RIF (1)

AA Sequence

MEKEKGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNEEWYRLQEKKM      1 - 70
EKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGHLDIVQELIAQGADVHAVTVD     71 - 140
GWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRDSKDTLELLLMNRYVKPGLKNNLEE    141 - 210
TAFDIARRTSIYHYLFEIVEGCTNSSPQS                                             211 - 239
//

Text Mined References (13)

PMID Year Title