Property Summary

NCBI Gene PubMed Count 26
PubMed Score 10.20
PubTator Score 15.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 1.400 5.5e-09
group 3 medulloblastoma 1.400 4.2e-03
juvenile dermatomyositis 1.006 7.2e-11

 GO Function (1)

Gene RIF (17)

AA Sequence

MEAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKSRYQTLYARFKPVAVE      1 - 70
QKESKSRICATVKKTMNMIQKLQKQTDLELSPLTKEEKTAAEQFKFHMPDL                        71 - 121
//

Text Mined References (32)

PMID Year Title