Property Summary

NCBI Gene PubMed Count 19
Grant Count 4
R01 Count 4
Funding $347,885.86
PubMed Score 13.76
PubTator Score 15.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.006 0.000
group 3 medulloblastoma 1.400 0.004
Breast cancer 1.400 0.000

Synonym

Accession Q8WVK7 A6NIL3 B3KPL3 E9PCB8
Symbols FAM33A

Gene

PDB

4AJ5  

 GO Function (1)

Gene RIF (10)

PMID Text
27038412 DNA methylation of the SKA2 gene has been implicated as a biomarker of suicide risk and posttraumatic stress disorder.
26324104 Results suggest that DNA methylation(adj) of SKA2 in blood indexes stress-related psychiatric phenotypes and neurobiology, pointing to its potential value as a biomarker of stress exposure and susceptibility.
26305478 SKA2 is hypothesized to reduce the ability to suppress cortisol following stress.
26162986 PRR11-SKA2 bidirectional transcription unit, which is a novel direct target of NF-Y, is essential for the accelerated proliferation and motility of lung cancer cells
25073599 SKA2 significantly interacted with anxiety and stress to explain about 80% of suicidal behavior and progression from suicidal ideation to suicide attempt.SKA2 is a novel genetic and epigenetic marker involved in the etiology of suicide, suicidal behaviors
22483620 The structure of the Ska core complex is a W-shaped dimer of coiled coils, formed by intertwined interactions between Ska1, Ska2, and Ska3.
22371557 Data suggest that Aurora B phosphorylation antagonizes the interaction between the Ska1-3 complex and the KMN network, thereby controlling Ska recruitment to KTs and stabilization of KT-MT attachments.
20470754 blocking of miR-301 in A549 cells leads to a decrease in the expression of the host gene, ska2.
18583474 Study discovered that FAM33A is protein partners for GRs and is involved in cell proliferation and GC signalling.
17093495 These data suggest that the Ska1/Ska2 complex plays a critical role in the maintenance of the metaphase plate and/or spindle checkpoint silencing.

AA Sequence

MEAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKSRYQTLYARFKPVAVE      1 - 70
QKESKSRICATVKKTMNMIQKLQKQTDLELSPLTKEEKTAAEQFKFHMPDL                        71 - 121
//

Text Mined References (25)

PMID Year Title
27038412 2016 EPIGENETIC VARIATION AT SKA2 PREDICTS SUICIDE PHENOTYPES AND INTERNALIZING PSYCHOPATHOLOGY.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26324104 2016 SKA2 methylation is associated with decreased prefrontal cortical thickness and greater PTSD severity among trauma-exposed veterans.
26305478 2015 Epigenetic and genetic variation at SKA2 predict suicidal behavior and post-traumatic stress disorder.
26162986 2015 The gene pair PRR11 and SKA2 shares a NF-Y-regulated bidirectional promoter and contributes to lung cancer development.
25073599 2014 Identification and replication of a combined epigenetic and genetic biomarker predicting suicide and suicidal behaviors.
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085020 2012 The kinetochore-bound Ska1 complex tracks depolymerizing microtubules and binds to curved protofilaments.
22483620 2012 Structural and functional organization of the Ska complex, a key component of the kinetochore-microtubule interface.
More...