Property Summary

NCBI Gene PubMed Count 11
PubMed Score 97.10
PubTator Score 12.83

Knowledge Summary

Patent

No data available

TINX Plot

Expression

AA Sequence

MGRSRSRSPRRERRRSRSTSRERERRRRERSRSRERDRRRSRSRSPHRRRSRSPRRHRSTSPSPSRLKER      1 - 70
RDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQY     71 - 140
MNRKGGFNRPLDFIA                                                           141 - 155
//

Text Mined References (15)

PMID Year Title