Property Summary

NCBI Gene PubMed Count 11
PubMed Score 93.28
PubTator Score 12.83

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession Q8WVK2 Q15410 U4/U6.U5 snRNP 27 kDa protein
Symbols 27K
RY1

Gene

AA Sequence

MGRSRSRSPRRERRRSRSTSRERERRRRERSRSRERDRRRSRSRSPHRRRSRSPRRHRSTSPSPSRLKER      1 - 70
RDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQY     71 - 140
MNRKGGFNRPLDFIA                                                           141 - 155
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21269460 2011 Initial characterization of the human central proteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16723661 2006 The network of protein-protein interactions within the human U4/U6.U5 tri-snRNP.
More...