Property Summary

NCBI Gene PubMed Count 50
Grant Count 48
R01 Count 22
Funding $4,701,912.16
PubMed Score 151.83
PubTator Score 68.22

Knowledge Summary

Patent

No data available

Expression

Gene RIF (37)

PMID Text
27048119 TWIST2 regulates epithelial-mesenchymal transition by depriving the epithelial cell phenotype of E-cadherin and endowing the mesenchymal cell phenotype with Vimentin, which may be involved in the progression and prognosis of ovarian cancer.
26842802 Findings indicated that HIF-2alpha promotes epithelial-mesenchymal transition in pancreatic cancer by regulating Twist2 binding to the promoter of E-cadherin.
26119818 A substituted lysine at TWIST2 residue 75 results in Ablepharon Macrostomia Syndrome, whereas a glutamine or alanine yields Barber-Say Syndrome.
26019273 After chronic NOD2 stimulation, Twist1 and Twist2 coordinate the regulation of both transcriptional activators and repressors, thereby mediating optimal cytokine down-regulation.
25895023 MACC1 promotes vasculogenic mimicry in gastric cancer by regulating the HGF/c-Met-TWIST1/2 signaling pathway.
25728400 In patients with no duplication/triplication of the 1p36.22p36.21 region and no mutations in TWIST2, there are mutation(s) in one of the 30 genes in this region or mutations in other as yet unidentified genes at different locations
25663706 TWIST1 and TWIST2 are expressed in skeletal muscle and remained unaltered in metabolic diseases.
25608809 Twist2 plays roles in osteogenesis differentiation, tumor formation and epithelial-mesenchymal transition.[review]
25528769 Data suggest that TWIST1 and to a lesser degree TWIST2 expressed within the tumor stroma could contribute to the epithelial-mesenchymal transition (EMT)-like tumor budding phenotype in colorectal cancers.
25420506 Results show that Twist2 expression was gradually increased during the progression from normal cervical squamous epithelium to cervical intraepithelial neoplasia (CIN) and cervical squamous cell carcinoma.
More...

AA Sequence

MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRIL      1 - 70
ANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHER     71 - 140
LSYAFSVWRMEGAWSMSASH                                                      141 - 160
//

Text Mined References (50)

PMID Year Title
27048119 2016 Role of TWIST2, E-cadherin and Vimentin in epithelial ovarian carcinogenesis and prognosis and their interaction in cancer progression.
26842802 2016 HIF-2? promotes epithelial-mesenchymal transition through regulating Twist2 binding to the promoter of E-cadherin in pancreatic cancer.
26119818 2015 Recurrent Mutations in the Basic Domain of TWIST2 Cause Ablepharon Macrostomia and Barber-Say Syndromes.
26019273 2015 Twist1 and Twist2 Contribute to Cytokine Downregulation following Chronic NOD2 Stimulation of Human Macrophages through the Coordinated Regulation of Transcriptional Repressors and Activators.
25895023 2015 Metastasis-associated in colon cancer-1 promotes vasculogenic mimicry in gastric cancer by upregulating TWIST1/2.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25728400 2015 Chromosome 1p36.22p36.21 duplications/triplication causes Setleis syndrome (focal facial dermal dysplasia type III).
25663706 2015 TWIST1 and TWIST2 regulate glycogen storage and inflammatory genes in skeletal muscle.
25608809 2015 Biological function and molecular mechanism of Twist2.
25528769 2015 TWIST1 and TWIST2 promoter methylation and protein expression in tumor stroma influence the epithelial-mesenchymal transition-like tumor budding phenotype in colorectal cancer.
More...