Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.05
PubTator Score 0.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.0e-04
Breast cancer 3578 2.7e-02
non primary Sjogren syndrome sicca 891 3.9e-02
Disease Target Count Z-score Confidence
Endometritis 21 4.456 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 3.200 2.7e-02
non primary Sjogren syndrome sicca 1.100 3.9e-02
ovarian cancer -1.900 1.0e-04

 GO Function (1)

Gene RIF (1)

AA Sequence

MSAPFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALSVGGREILKGKLFDST      1 - 70
IADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFSGAE     71 - 140
ISGNYTKGGPDFSNLEK                                                         141 - 157
//

Text Mined References (19)

PMID Year Title