Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.05
PubTator Score 0.73

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 3.200 0.027
non primary Sjogren syndrome sicca 1.100 0.039
ovarian cancer -1.900 0.000

Synonym

Accession Q8WVJ2 B2R4V0
Symbols NudCL2

Gene

 GO Function (1)

Gene RIF (1)

PMID Text
20133715 NudCL2, a homolog of Aspergillus NudC, which shares significant homology with human NudC and NudCL was identified. It regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90 chaperone.

AA Sequence

MSAPFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALSVGGREILKGKLFDST      1 - 70
IADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFSGAE     71 - 140
ISGNYTKGGPDFSNLEK                                                         141 - 157
//

Text Mined References (19)

PMID Year Title
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20133715 2010 NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...