Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.00
PubTator Score 9.04

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.800 1.6e-04
atypical teratoid / rhabdoid tumor 1.100 9.8e-04
medulloblastoma, large-cell 1.300 1.1e-04
ovarian cancer 1.300 3.3e-08
pituitary cancer 1.300 3.0e-03

Gene RIF (6)

AA Sequence

MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRK      1 - 70
QSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH                                    71 - 109
//

Text Mined References (13)

PMID Year Title