Property Summary

NCBI Gene PubMed Count 8
Grant Count 8
R01 Count 7
Funding $296,768.15
PubMed Score 23.93
PubTator Score 0.97

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
21785413 CPX acts sequentially on assembling SNAREpins, first facilitating zippering by nearly doubling the distance at which v- and t-SNAREs can engage and then clamping them into a half-zippered fusion-incompetent state.

AA Sequence

MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQRKAERA      1 - 70
TLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKASVLGQLASLPGLNLGSLKDK     71 - 140
AQATLGDLKQSAEKCHVM                                                        141 - 158
//

Text Mined References (10)

PMID Year Title
21876539 2012 Genome-wide association analysis of coffee drinking suggests association with CYP1A1/CYP1A2 and NRCAM.
21785413 2011 Complexin activates and clamps SNAREpins by a common mechanism involving an intermediate energetic state.
21490707 2011 Genome-wide meta-analysis identifies regions on 7p21 (AHR) and 15q24 (CYP1A2) as determinants of habitual caffeine consumption.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
15911881 2005 Structurally and functionally unique complexins at retinal ribbon synapses.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12934113 2003 Expression profiling and characterization of 4200 genes cloned from primary neuroblastomas: identification of 305 genes differentially expressed between favorable and unfavorable subsets.
12880961 2003 Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.