Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -3.000 0.013
ependymoma -3.200 0.001
oligodendroglioma -2.800 0.020
glioblastoma multiforme -2.400 0.000
medulloblastoma -2.800 0.000
cystic fibrosis 3.401 0.000
atypical teratoid / rhabdoid tumor -2.200 0.001
medulloblastoma, large-cell -2.900 0.001
adult high grade glioma -1.800 0.004
psoriasis 1.300 0.000
spina bifida -2.253 0.043
Pick disease -1.100 0.010

Synonym

Accession Q8WVF5 Q5W0P9
Symbols bA321C24.3

Gene

PANTHER Protein Class (1)

 Compartment GO Term (1)

AA Sequence

MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCP      1 - 70
FDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVKSRWEKEQLTPRET     71 - 140
TFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIQFKYFIKSENGTRLVL    141 - 210
KEDNTFVCTLETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK                         211 - 259
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.