Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.400 1.0e-02
astrocytic glioma -2.500 1.2e-03
atypical teratoid / rhabdoid tumor -1.800 1.0e-03
cystic fibrosis 3.401 2.9e-08
ependymoma -3.200 1.1e-03
glioblastoma -1.400 5.8e-04
group 3 medulloblastoma -2.100 4.6e-03
medulloblastoma, large-cell -2.000 7.7e-03
oligodendroglioma -2.700 1.2e-03
Pick disease -1.100 1.0e-02
psoriasis 1.300 1.3e-05
spina bifida -2.253 4.3e-02

AA Sequence

MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCP      1 - 70
FDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVKSRWEKEQLTPRET     71 - 140
TFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIQFKYFIKSENGTRLVL    141 - 210
KEDNTFVCTLETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK                         211 - 259
//

Text Mined References (8)

PMID Year Title