Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.26
PubTator Score 9.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.3e-11
Pilocytic astrocytoma 56 3.2e-05
Disease Target Count Z-score Confidence
Paget's disease of bone 36 3.104 1.6

Gene RIF (7)

AA Sequence

MTWRQAVLLSCFSAVVLLSMLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRD      1 - 70
EVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT       71 - 138
//

Text Mined References (11)

PMID Year Title