Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.09
PubTator Score 9.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (6)

PMID Text
26337479 The study demonstrates the involvement of GRP in the two major molecular processes affecting osteoarthritis: mineralization and inflammation of articular tissue.
24867294 Data suggest that novel splice variants of GRP are expressed in cartilage and other tissues (i.e. GRP-F5, GRP-F6); GRP-F1 is predominant splice variant expressed in adult tissues particularly in cartilage of patients with osteoarthritis.
24409676 full exon resequencing of DNA samples from 17 chronic kidney disease patients (stage 5) and 121 healthy controls in a Swsedish population; the 138Thr > Ser polymorphism seems to be the only non-synonymous SNP found in the UCMA gene in a Swedish population
18836183 Gla-rich protein (GRP) is a new vitamin K-dependent protein that can bind calcium through Gla residues.
18156182 Ucma may be involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells
17707622 The present data strongly suggest an important function of Ucma in the early phase of chondrocyte differentiation.

AA Sequence

MTWRQAVLLSCFSAVVLLSMLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRD      1 - 70
EVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT       71 - 138
//

Text Mined References (10)

PMID Year Title
26337479 2016 Gla-rich protein is involved in the cross-talk between calcification and inflammation in osteoarthritis.
24867294 2014 Insights into the association of Gla-rich protein and osteoarthritis, novel splice variants and ?-carboxylation status.
24409676 2013 Exon resequencing of the gene encoding UCma/GRP reveals a common carboxy-terminal 138Thr > Ser polymorphism.
18836183 2008 Gla-rich protein (GRP), a new vitamin K-dependent protein identified from sturgeon cartilage and highly conserved in vertebrates.
18156182 2008 Ucma, a novel secreted cartilage-specific protein with implications in osteogenesis.
17707622 2008 Ucma--A novel secreted factor represents a highly specific marker for distal chondrocytes.
16176871 2005 Expression profiling of human fetal growth plate cartilage by EST sequencing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.