Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.18
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 6.70675079807898E-12
ependymoma 2514 2.07734080261535E-7
atypical teratoid / rhabdoid tumor 4369 1.44396135961204E-4
primary pancreatic ductal adenocarcinoma 1271 9.61967022683062E-4
ovarian cancer 8492 0.00136019376989761
osteosarcoma 7933 0.00739542425440702
invasive ductal carcinoma 2950 0.0284284738851925
Disease Target Count Z-score Confidence
ulcerative colitis 2087 0.0 1.0

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.020 0.007
ependymoma 1.200 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
juvenile dermatomyositis 1.011 0.000
primary pancreatic ductal adenocarcinoma 1.540 0.001
invasive ductal carcinoma 1.100 0.028
ulcerative colitis -1.300 0.000
ovarian cancer -1.400 0.001

Synonym

Accession Q8WVE7 B2R4R3 B4DPS4 D3DUK2 Q7Z6F3
Symbols TMEM170

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
23152477 This study identified rs4888378 in the BCAR1-CFDP1-TMEM170A locus as a novel genetic determinant of carotid intima-media thickness and coronary artery disease risk.
19844255 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEREGSGGSGGSAGLLQQILSLKVVPRVGNGTLCPNSTSLCSFPEMWYGVFLWALVSSLFFHVPAGLLAL      1 - 70
FTLRHHKYGRFMSVSILLMGIVGPITAGILTSAAIAGVYRAAGKEMIPFEALTLGTGQTFCVLVVSFLRI     71 - 140
LATL                                                                      141 - 144
//

Text Mined References (10)

PMID Year Title
26906412 2016 Transmembrane protein TMEM170A is a newly discovered regulator of ER and nuclear envelope morphogenesis in human cells.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
23152477 2012 Identification of the BCAR1-CFDP1-TMEM170A locus as a determinant of carotid intima-media thickness and coronary artery disease risk.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.