Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.18
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ulcerative colitis -1.300 9.2e-09
atypical teratoid / rhabdoid tumor 1.100 1.4e-04
ependymoma 1.200 2.1e-07
invasive ductal carcinoma 1.100 2.8e-02
juvenile dermatomyositis 1.011 6.7e-12
osteosarcoma -1.020 7.4e-03
ovarian cancer -1.400 1.4e-03
primary pancreatic ductal adenocarcinoma 1.540 9.6e-04

Gene RIF (3)

AA Sequence

MEREGSGGSGGSAGLLQQILSLKVVPRVGNGTLCPNSTSLCSFPEMWYGVFLWALVSSLFFHVPAGLLAL      1 - 70
FTLRHHKYGRFMSVSILLMGIVGPITAGILTSAAIAGVYRAAGKEMIPFEALTLGTGQTFCVLVVSFLRI     71 - 140
LATL                                                                      141 - 144
//

Text Mined References (10)

PMID Year Title