Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.06
PubTator Score 13.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.54838044362468E-108
ulcerative colitis 2087 1.39019335196157E-7
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00108893132996949
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00156940576124316
gastric carcinoma 832 0.013519929775489
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0253659346852121
Disease Target Count Z-score Confidence
Gout 93 3.383 1.7
Kidney disease 397 0.0 1.0

Expression

Synonym

Accession Q8WVE6 Q8N0S1 Q8TDT7
Symbols PRP2

Gene

  Ortholog (10)

AA Sequence

MSPAAAAEPDGDQQDRHVSKLIFCFFVFGAVLLCVGVLLSIFGFQACQYKPLPDCPMVLKVAGPACAVVG      1 - 70
LGAVILARSRAQLQLRAGLQRGQQMDPDRAFICGESRQFAQCLIFGFLFLTSGMLISVLGIWVPGCGSNW     71 - 140
AQEPLNETDTGDSEPRMCGFLSLQIMGPLIVLVGLCFFVVAHVKKRNTLNAGQDASEREEGQIQIMEPVQ    141 - 210
VTVGDSVIIFPPPPPPYFPESSASAVAESPGTNSLLPNENPPSYYSIFNYGRTPTSEGAASERDCESIYT    211 - 280
ISGTNSSSEASHTPHLPSELPPRYEEKENAAATFLPLSSEPSPP                              281 - 324
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
22797727 2012 Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.