Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.00
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
medulloblastoma, large-cell 6241 5.7e-03
acute myeloid leukemia 783 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Otitis Media 52 3.036 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia -3.100 2.7e-02
medulloblastoma, large-cell -1.100 5.7e-03

Gene RIF (1)

AA Sequence

MSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAA      1 - 70
VGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIA     71 - 140
DPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGL    141 - 210
DCGI                                                                      211 - 214
//

Text Mined References (12)

PMID Year Title