Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.40
PubTator Score 1.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
cystic fibrosis -1.035 4.4e-05
esophageal adenocarcinoma -1.800 2.2e-02
interstitial cystitis -1.100 3.9e-04
malignant mesothelioma -1.700 9.8e-06
medulloblastoma, large-cell -1.900 3.7e-04
ovarian cancer -1.900 3.3e-07
spina bifida -1.393 4.9e-02
tuberculosis 1.100 4.7e-06
urothelial carcinoma -1.200 1.1e-02

Gene RIF (2)

AA Sequence

MGQQISDQTQLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHLLFEVQPGSDS      1 - 70
SAFWKVVVRVVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQAS     71 - 140
LWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESWVVSDAPTE    141 - 210
DDMANYILNMADEAGQPHRP                                                      211 - 230
//

Text Mined References (12)

PMID Year Title