Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.35
PubTator Score 1.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
urothelial carcinoma -1.300 0.017
malignant mesothelioma -1.700 0.000
esophageal adenocarcinoma -1.800 0.022
cystic fibrosis -1.035 0.000
medulloblastoma, large-cell -1.900 0.000
tuberculosis and treatment for 6 months 1.400 0.000
interstitial cystitis -1.100 0.000
spina bifida -1.562 0.037
ovarian cancer -1.900 0.000

Gene RIF (1)

PMID Text
12804569 Analysis of the mouse counterpart.

AA Sequence

MGQQISDQTQLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHLLFEVQPGSDS      1 - 70
SAFWKVVVRVVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQAS     71 - 140
LWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESWVVSDAPTE    141 - 210
DDMANYILNMADEAGQPHRP                                                      211 - 230
//

Text Mined References (11)

PMID Year Title
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24105792 2014 Protein microarray characterization of the S-nitrosoproteome.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12804569 2003 Molecular cloning and characterization of a mouse spermatogenesis-related ring finger gene znf230.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11672448 2001 The shorter zinc finger protein ZNF230 gene message is transcribed in fertile male testes and may be related to human spermatogenesis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
More...