Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.53
PubTator Score 7.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
dermatomyositis 1.200 6.2e-03
glioblastoma 1.500 1.2e-02
group 3 medulloblastoma 1.200 1.6e-03
juvenile dermatomyositis 1.016 1.0e-09
malignant mesothelioma 1.400 7.7e-06
medulloblastoma, large-cell 1.200 9.7e-05
Multiple myeloma 1.556 2.9e-03
osteosarcoma -1.315 1.1e-03
ovarian cancer -1.100 6.4e-03
primary Sjogren syndrome 1.200 1.6e-03
primitive neuroectodermal tumor 1.200 1.4e-04
Rheumatoid arthritis 1.700 2.6e-02
sarcoidosis 1.100 3.7e-03
tuberculosis and treatment for 6 months 1.400 1.7e-05
Waldenstrons macroglobulinemia 1.522 2.6e-02

Gene RIF (8)

AA Sequence

MAEDLSAATSYTEDDFYCPVCQEVLKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRRERACPE      1 - 70
RALDLENIMRKFSGSCRCCAKQIKFYRMRHHYKSCKKYQDEYGVSSIIPNFQISQDSVGNSNRSETSTSD     71 - 140
NTETYQENTSSSGHPTFKCPLCQESNFTRQRLLDHCNSNHLFQIVPVTCPICVSLPWGDPSQITRNFVSH    141 - 210
LNQRHQFDYGEFVNLQLDEETQYQTAVEESFQVNI                                       211 - 245
//

Text Mined References (23)

PMID Year Title