Property Summary

NCBI Gene PubMed Count 16
Grant Count 1
Funding $108,442
PubMed Score 11.92
PubTator Score 7.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Synonym

Accession Q8WVD3 B2RE17 Q9H8K2 Q9UF87 Q9UKI6
Symbols NARF
HSD-4
STRIN
hNARF

Gene

PANTHER Protein Class (2)

 Grant Application (1)

Gene RIF (5)

PMID Text
26502057 Data show that ubiquitin E2 enzymes UBE2D1/2/3 and E3 ligase RNF138 accumulate at DNA-damage sites and act at early resection stages by promoting CtIP protein ubiquitylation and accrual.
26502055 Data show that ubiquitin E3 ligase RNF138 regulates Ku80 antigen ubiquitylation in response to DNA damage.
22155992 The RNF138 gene is highly expressed in glioma tissue and glioma cell lines and plays an important role in glioma cell proliferation, apoptosis, and cell cycle.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16714285 NARF functions as a novel ubiquitin-ligase to regulate ubiquitylation and degradation of T cell factor/lymphoid enhancer factor

AA Sequence

MAEDLSAATSYTEDDFYCPVCQEVLKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRRERACPE      1 - 70
RALDLENIMRKFSGSCRCCAKQIKFYRMRHHYKSCKKYQDEYGVSSIIPNFQISQDSVGNSNRSETSTSD     71 - 140
NTETYQENTSSSGHPTFKCPLCQESNFTRQRLLDHCNSNHLFQIVPVTCPICVSLPWGDPSQITRNFVSH    141 - 210
LNQRHQFDYGEFVNLQLDEETQYQTAVEESFQVNI                                       211 - 245
//

Text Mined References (20)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26502057 2015 Systematic E2 screening reveals a UBE2D-RNF138-CtIP axis promoting DNA repair.
26502055 2015 The RNF138 E3 ligase displaces Ku to promote DNA end resection and regulate DNA repair pathway choice.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22155992 2012 A novel gene RNF138 expressed in human gliomas and its function in the glioma cell line U251.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...