Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.400 7.6e-03
inflammatory breast cancer -1.200 2.7e-04
lung cancer 1.200 1.4e-04
lung carcinoma 1.100 8.8e-27
osteosarcoma 1.342 6.6e-04
posterior fossa group B ependymoma 1.300 2.4e-04

 GO Component (2)

 Compartment GO Term (1)

Gene RIF (2)

AA Sequence

MFLVGLTGGIASGKSSVIQVFQQLGCAVIDVDVMARHVVQPGYPAHRRIVEVFGTEVLLENGDINRKVLG      1 - 70
DLIFNQPDRRQLLNAITHPEIRKEMMKETFKYFLRGYRYVILDIPLLFETKKLLKYMKHTVVVYCDRDTQ     71 - 140
LARLMRRNSLNRKDAEARINAQLPLTDKARMARHVLDNSGEWSVTKRQVILLHTELERSLEYLPLRFGVL    141 - 210
TGLAAIASLLYLLTHYLLPYA                                                     211 - 231
//

Text Mined References (9)

PMID Year Title