Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 8.84441917203427E-27
lung cancer 4473 1.43716655636141E-4
posterior fossa group B ependymoma 1530 2.35717053692914E-4
inflammatory breast cancer 404 2.67874055286571E-4
osteosarcoma 7933 6.59473931564059E-4
group 3 medulloblastoma 2254 0.00758060634567341

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.342 0.001
lung cancer 1.200 0.000
group 3 medulloblastoma 1.400 0.008
posterior fossa group B ependymoma 1.300 0.000
inflammatory breast cancer -1.200 0.000
lung carcinoma 1.100 0.000

Synonym

Accession Q8WVC6 A8K3Z0 D3DX60 D3DX62 Q9BR71 Q9H5W1
Symbols

Gene

  Ortholog (14)

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MFLVGLTGGIASGKSSVIQVFQQLGCAVIDVDVMARHVVQPGYPAHRRIVEVFGTEVLLENGDINRKVLG      1 - 70
DLIFNQPDRRQLLNAITHPEIRKEMMKETFKYFLRGYRYVILDIPLLFETKKLLKYMKHTVVVYCDRDTQ     71 - 140
LARLMRRNSLNRKDAEARINAQLPLTDKARMARHVLDNSGEWSVTKRQVILLHTELERSLEYLPLRFGVL    141 - 210
TGLAAIASLLYLLTHYLLPYA                                                     211 - 231
//

Text Mined References (9)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
17567985 2007 Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.