Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.83
PubTator Score 36.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 4.2e-08
oligodendroglioma 2850 2.4e-03
ependymoma 4679 2.9e-03
astrocytic glioma 2597 3.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma 1.100 3.6e-03
ependymoma 1.100 2.9e-03
oligodendroglioma 1.300 2.4e-03
tuberculosis 1.300 4.2e-08

Gene RIF (6)

AA Sequence

MSGSTPFQMRLVHLDLKGAPPKVSYLSEIFPLFRALGANGLLIEYEDMFPYEGPLRLLRAKYAYSPSEIK      1 - 70
EILHLAGLNELEVIPLVQTFGHMEFVLKHTAFAHLREVGSFPCTLNPHEAESLALVGAMIDQVLELHPGA     71 - 140
QRLHIGCDEVYYLGEGEASRRWLQQEQNSTGKLCLSHMRAVASGVKARRPSVTPLVWDDMLRDLPEDQLA    141 - 210
ASGVPQLVEPVLWDYTADLDVHGKVLLMQKYRRCGFPQLWAASAFKGATGPSQAVPPVEHHLRNHVQWLQ    211 - 280
VAGSGPTDSLQGIILTGWQRYDHYSVLCELLPAGVPSLAACLQLLLRGGFDEDVKAKVENLLGISSLEKT    281 - 350
DPVREGAGSFPGSNILALVTQVSLHLRSSVDALLEGNRYVTGWFSPYHRQRKLIHPVMVQHIQPAALSLL    351 - 420
AQWSTLVQELEAALQLAFYPDAVEEWLEENVHPSLQRLQALLQDLSEVSAPPLPPTSPGRDVAQDP        421 - 486
//

Text Mined References (11)

PMID Year Title