Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.60
PubTator Score 4.79

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
26692333 Consistent with its proposed role as a tumor suppressor of myeloid transformation, AIRAPL expression is widely abrogated in human myeloproliferative disorders.
26337389 Results demonstrate that on specific translocation inhibition, a p97-AIRAPL complex directly binds and regulates the efficient processing of polyubiquitinated pQC substrates by the UPS. Results also demonstrate p97's role in pQC processing of preproinsulin in cases of naturally occurring mutations within the signal sequence of insulin.
24215362 Zinc finger proteins may be associated with pathophysiology of severe dry eye syndrome.
24160817 AIRAPL binds to p97 and forms a complex in the endoplasmic reticulum membrane.
19414486 An AIP-1 human homologue, ZFAND2B, has a similar protective effect against Abeta toxicity.

AA Sequence

MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLCNVPVPVARGE      1 - 70
PPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHPLDHDCSGEGHP     71 - 140
TSRAGLAAISRAQAVASTSTVPSPSQTMPSCTSPSRATTRSPSWTAPPVIALQNGLSEDEALQRALEMSL    141 - 210
AETKPQVPSCQEEEDLALAQALSASEAEYQRQQAQSRSSKPSNCSLC                           211 - 257
//

Text Mined References (16)

PMID Year Title
26692333 2016 Loss of the proteostasis factor AIRAPL causes myeloid transformation by deregulating IGF-1 signaling.
26337389 2015 Proteasomal degradation of preemptive quality control (pQC) substrates is mediated by an AIRAPL-p97 complex.
25416956 2014 A proteome-scale map of the human interactome network.
24215362 2014 Zinc finger protein in severe dry eye syndrome.
24160817 2014 Signal-peptide-mediated translocation is regulated by a p97-AIRAPL complex.
21896481 2011 The general definition of the p97/valosin-containing protein (VCP)-interacting motif (VIM) delineates a new family of p97 cofactors.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19414486 2009 AIP-1 ameliorates beta-amyloid peptide toxicity in a Caenorhabditis elegans Alzheimer's disease model.
19060904 2009 An empirical framework for binary interactome mapping.
18467495 2008 Proteasomal adaptation to environmental stress links resistance to proteotoxicity with longevity in Caenorhabditis elegans.
More...