Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.60
PubTator Score 4.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

Gene RIF (5)

AA Sequence

MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLCNVPVPVARGE      1 - 70
PPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHPLDHDCSGEGHP     71 - 140
TSRAGLAAISRAQAVASTSTVPSPSQTMPSCTSPSRATTRSPSWTAPPVIALQNGLSEDEALQRALEMSL    141 - 210
AETKPQVPSCQEEEDLALAQALSASEAEYQRQQAQSRSSKPSNCSLC                           211 - 257
//

Text Mined References (16)

PMID Year Title