Property Summary

NCBI Gene PubMed Count 15
PubMed Score 109.34
PubTator Score 56.54

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WV93 Q8N6A3
Symbols AFG1
c222389

Gene

PANTHER Protein Class (1)

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (7)

PMID Text
26759378 This study establishes LACE1 as a novel factor with a crucial role in mitochondrial protein homeostasis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20872768 association between bipolar disorder and two SNPs in the gene LACE1
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18237552 Observational study of genetic testing. (HuGE Navigator)

AA Sequence

MAASWSLLVTLRPLAQSPLRGRCVGCGAWAAALAPLATAPGKPFWKAYTVQTSESMTPTATSETYLKALA      1 - 70
VCHGPLDHYDFLIKAHELKDDEHQRRVIQCLQKLHEDLKGYNIEAEGLFSKLFSRSKPPRGLYVYGDVGT     71 - 140
GKTMVMDMFYAYVEMKRKKRVHFHGFMLDVHKRIHRLKQSLPKRKPGFMAKSYDPIAPIAEEISEEACLL    141 - 210
CFDEFQVTDIADAMILKQLFENLFKNGVVVVATSNRPPEDLYKNGLQRANFVPFIAVLKEYCNTVQLDSG    211 - 280
IDYRKRELPAAGKLYYLTSEADVEAVMDKLFDELAQKQNDLTRPRILKVQGRELRLNKACGTVADCTFEE    281 - 350
LCERPLGASDYLELSKNFDTIFLRNIPQFTLANRTQGRRFITLIDNFYDLKVRIICSASTPISSLFLHQH    351 - 420
HDSELEQSRILMDDLGLSQDSAEGLSMFTGEEEIFAFQRTISRLTEMQTEQYWNEGDRTKK             421 - 481
//

Text Mined References (17)

PMID Year Title
26759378 2016 The mammalian homologue of yeast Afg1 ATPase (lactation elevated 1) mediates degradation of nuclear-encoded complex IV subunits.
25416956 2014 A proteome-scale map of the human interactome network.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21690554 2011 Identification of FOXO3 and PRDM1 as tumor-suppressor gene candidates in NK-cell neoplasms by genomic and functional analyses.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20872768 2010 An investigation of candidate regions for association with bipolar disorder.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...