Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.10
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q8WV92 Q69YV0
Symbols

Gene

PDB

2YMB   4A5X   4A5Z  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMD      1 - 70
RAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWIEDPYIRHTHQLYNFLRFCEM     71 - 140
LIKRPCKVKTIHLLTSLDEGIEQVQQSRGLQEIEESLRSHGVLLEVQYSSSIHDREIRFNNGWMIKIGRG    141 - 210
LDYFKKPQSRFSLGYCDFDLRPCHETTVDIFHKKHTKNI                                   211 - 249
//

Text Mined References (19)

PMID Year Title