Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.21
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WV92 Q69YV0
Symbols

Gene

PDB

2YMB   4A5X   4A5Z  

Gene RIF (3)

PMID Text
23045692 results suggest a model whereby MITD1 coordinates the activity of ESCRT-III during abscission with earlier events in the final stages of cell division
23015756 MITD1 participates in the abscission phase of cytokinesis and ESCRT-III subunits are important for the recruitment of MITD1 to the midbody.
22190034 HIV-1 Rev is identified to have a physical interaction with microtubule interacting and transport, domain containing 1 (MITD1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMD      1 - 70
RAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWIEDPYIRHTHQLYNFLRFCEM     71 - 140
LIKRPCKVKTIHLLTSLDEGIEQVQQSRGLQEIEESLRSHGVLLEVQYSSSIHDREIRFNNGWMIKIGRG    141 - 210
LDYFKKPQSRFSLGYCDFDLRPCHETTVDIFHKKHTKNI                                   211 - 249
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23045692 2012 ESCRT-III binding protein MITD1 is involved in cytokinesis and has an unanticipated PLD fold that binds membranes.
23015756 2012 MITD1 is recruited to midbodies by ESCRT-III and participates in cytokinesis.
22190034 2011 Global landscape of HIV-human protein complexes.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21269460 2011 Initial characterization of the human central proteome.
19129480 2009 Essential role of hIST1 in cytokinesis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...