Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.01
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.1e-05
osteosarcoma 7950 2.0e-04
medulloblastoma, large-cell 6241 1.4e-03
medulloblastoma 720 1.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma -1.100 1.8e-03
medulloblastoma, large-cell -1.300 1.4e-03
osteosarcoma 1.550 2.0e-04
ovarian cancer -1.100 2.1e-05

Gene RIF (1)

AA Sequence

MVRDSMAAAFRPSNRVLLQALQILVYPGVGGSGSVSCRCPLGAKRYLLTDNVVKLKEFQQKKVAVACNLS      1 - 70
GTKETYFRNLKKKLTQNKLILKGELITLLHLCESRDHVELAKNVIYRYHAENKNFTLGEYKFGPLFVRLC     71 - 140
YELDLEESAVELMKDQHLRGFFSDSTSFNILMDMLFIKGKYKSALQVLIEMKNQDVKFTKDTYVLAFAIC    141 - 210
YKLNSPESFKICTTLREEALLKGEILSRRASCFAVALALNQNEMAKAVSIFSQIMNPESIACINLNIIIH    211 - 280
IQSNMLENLIKTLKNAAEGNLSKFVKRHVFSEEVLAKVREKVKDVPALVAKFDEIYGTLHITGQVTTDSL    281 - 350
DAVLCHTPRDRKSHTLLLNKRMVSRRTFQPLSQSLLAE                                    351 - 388
//

Text Mined References (10)

PMID Year Title