Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma -1.300 3.0e-04
ductal carcinoma in situ -1.200 3.2e-04
invasive ductal carcinoma -1.500 1.9e-03
medulloblastoma, large-cell -1.200 3.0e-04
non primary Sjogren syndrome sicca 1.200 2.1e-02
osteosarcoma -1.654 2.7e-06

AA Sequence

MAGAVSLLGVVGLLLVSALSGVLGDRANPDLRAHPGNAAHPGSGATEPRRRPPLKDQRERTRAGSLPLGA      1 - 70
LYTAAVAAFVLYKCLQGKDETAVLHEEASKQQPLQSEQQLAQLTQQLAQTEQHLNNLMAQLDPLFERVTT     71 - 140
LAGAQQELLNMKLWTIHELLQDSKPDKDMEASEPGEGSGGESAGGGDKVSETGTFLISPHTEASRPLPED    141 - 210
FCLKEDEEEIGDSQAWEEPTNWSTETWNLATSWEVGRGLRRRCSQAVAKGPSHSLGWEGGTTAEGRLKQS    211 - 280
LFS                                                                       281 - 283
//

Text Mined References (6)

PMID Year Title