Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.34
PubTator Score 5.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell -1.200 0.000
lung carcinoma -1.100 0.000
invasive ductal carcinoma -1.100 0.001
ovarian cancer -1.500 0.000

Synonym

Accession Q8WV41 B1NM17
Symbols SNX30
SH3PX3
SH3PXD3C

Gene

PDB

4AKV  

Gene RIF (6)

PMID Text
22718350 The sorting nexin 9 (SNX9) subfamily members - SNX9, SNX18 and SNX33 - are required for progression and completion of mitosis.
20964629 study identifies critical amino acids within the BAR domains of SNX9 and SNX33 as determinants for the specificity of BAR domain-mediated interactions and suggests that SNX9 and SNX33 have distinct molecular functions.
19718658 Alternative splicing of ADAM15 regulates its interactions with cellular SH3 proteins SNX33 and nephrocystin
19487689 SNX33 plays a role in maintaining cell shape and cell cycle progression through its interaction with WASp
18419754 SNX33 interferes with cellular PrP formation by modulation of PrP shedding
18353773 identifies SNX33 as a new endocytic protein, which modulates amyloid precursor protein endocytosis and APP alpha-secretase cleavage, and demonstrates that the rate of APP endocytosis is a major control factor for APP alpha-secretase cleavage

AA Sequence

MALKGRALYDFHSENKEEISIQQDEDLVIFSETSLDGWLQGQNSRGETGLFPASYVEIVRSGISTNHADY      1 - 70
SSSPAGSPGAQVSLYNSPSVASPARSGGGSGFLSNQGSFEEDDDDDWDDWDDGCTVVEEPRAGGLGTNGH     71 - 140
PPLNLSYPGAYPSQHMAFRPKPPLERQDSLASAKRGSVVGRNLNRFSCFVRSGVEAFILGDVPMMAKIAE    141 - 210
TYSIEMGPRGPQWKANPHPFACSVEDPTKQTKFKGIKSYISYKLTPTHAASPVYRRYKHFDWLYNRLLHK    211 - 280
FTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEK    281 - 350
DEMVGASFLLTFQIPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSTVASELVRKHVGGFRKEFQKLGSA    351 - 420
FQAISHSFQMDPPFCSEALNSAISHTGRTYEAIGEMFAEQPKNDLFQMLDTLSLYQGLLSNFPDIIHLQK    421 - 490
GAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQNYLRQQILFYQRV    491 - 560
GQQLEKTLRMYDNL                                                            561 - 574
//

Text Mined References (20)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085988 2012 Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules.
22718350 2012 SNX9, SNX18 and SNX33 are required for progression through and completion of mitosis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21048941 2010 The SNX-PX-BAR family in macropinocytosis: the regulation of macropinosome formation by SNX-PX-BAR proteins.
20964629 2011 Specific amino acids in the BAR domain allow homodimerization and prevent heterodimerization of sorting nexin 33.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19718658 2009 Alternative splicing of ADAM15 regulates its interactions with cellular SH3 proteins.
19487689 2009 Sorting nexin 33 induces mammalian cell micronucleated phenotype and actin polymerization by interacting with Wiskott-Aldrich syndrome protein.
More...