Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.07
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WV35 B2RE92 Q9UKA0
Symbols FBL9
FBXL9

Gene

  Ortholog (1)

Species Source Disease
Rat OMA Inparanoid

 Compartment GO Term (1)

AA Sequence

MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKSRPELEHQASGTKDACPEPQGPS      1 - 70
LLTLRALQELDLTACSKLTDASLAKVLQFLQLRQLSLSLLPELTDNGLVAVARGCPSLEHLALSHCSRLS     71 - 140
DKGWAQAASSWPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVATCPGINMAAVRRFQAQLPQVSCVQ    141 - 210
SRFVGGADLTLTL                                                             211 - 223
//

Text Mined References (5)

PMID Year Title