Property Summary

NCBI Gene PubMed Count 54
Grant Count 158
R01 Count 104
Funding $27,378,310.28
PubMed Score 568.19
PubTator Score 203.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Synonym

Accession Q8WV28 O75498 O75499 Q2MD49
Symbols bca
AGM4
BASH
LY57
SLP65
BLNK-S
SLP-65

Gene

PANTHER Protein Class (1)

Gene RIF (18)

PMID Text
25140054 vesicular signaling scaffolds are required for B cell activation indicates that vesicles may deliver preassembled signaling cargo to sites of BCR activation.
24166973 early Ca(2+) fluxing provides feed-forward signal amplification by promoting anchoring of the PLCgamma2 C2 domain to phospho-SLP65.
22689681 up-regulation of BLNK is associated with RUNX1 mutations in cytogenetically normal acute myeloid leukemia.
21822214 Live cell imaging and co-immunoprecipitation experiments confirmed that both SLP65 and CIN85 are both required for the onset and progression phases of B-cell antigen receptor signal transduction.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19372136 Data show that SLP-65 phosphorylation acts upstream for signal initiation and also downstream during selective processing of the B cell receptor signal.
19218240 BLNK recruits active H-Ras to the BCR complex, which is essential for sustained surface expression of BCR in the form of the cap and for the signal leading to functional ERK activation
19018766 BLNK prevents aneuploidy by inhibiting cytokinesis.
More...

AA Sequence

MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDS      1 - 70
DYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKP     71 - 140
SWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRST    141 - 210
KPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAER    211 - 280
HRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGA    281 - 350
CDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFG    351 - 420
SVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS                                      421 - 456
//

Text Mined References (56)

PMID Year Title
25140054 2014 Macromolecular assembly of the adaptor SLP-65 at intracellular vesicles in resting B cells.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24166973 2013 Cutting edge: feed-forward activation of phospholipase C?2 via C2 domain-mediated binding to SLP65.
22689681 2012 RUNX1 mutations in cytogenetically normal acute myeloid leukemia are associated with a poor prognosis and up-regulation of lymphoid genes.
21930792 2011 SCIMP, a transmembrane adaptor protein involved in major histocompatibility complex class II signaling.
21822214 2011 The B-cell antigen receptor signals through a preformed transducer module of SLP65 and CIN85.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19641626 2009 Local network topology in human protein interaction data predicts functional association.
More...