Property Summary

NCBI Gene PubMed Count 54
PubMed Score 659.37
PubTator Score 203.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Agammaglobulinemia 34 0.0 0.0
Disease Target Count Z-score Confidence
Urinary bladder cancer 36 6.75 3.4
Breast cancer 3578 4.839 2.4

Expression

  Differential Expression (21)

Disease log2 FC p
acute myeloid leukemia -2.500 2.7e-03
adult high grade glioma 1.700 1.1e-02
Astrocytoma, Pilocytic 2.200 1.4e-06
colon cancer -1.900 4.0e-02
cutaneous lupus erythematosus 1.400 8.2e-04
cystic fibrosis 1.100 3.2e-04
ductal carcinoma in situ 1.500 4.4e-05
glioblastoma 1.100 2.5e-02
group 3 medulloblastoma -1.500 1.1e-02
intraductal papillary-mucinous adenoma (... 1.600 4.1e-04
intraductal papillary-mucinous carcinoma... 1.300 8.4e-03
invasive ductal carcinoma 1.428 5.0e-05
lung cancer -1.400 8.7e-03
lung carcinoma -1.100 6.1e-16
medulloblastoma, large-cell -1.300 3.0e-03
osteosarcoma -3.711 5.6e-05
ovarian cancer 1.100 1.4e-03
primary Sjogren syndrome 1.900 1.2e-03
psoriasis 1.100 2.8e-29
subependymal giant cell astrocytoma 2.507 5.0e-03
tuberculosis 1.100 7.9e-03

Synonym

Accession Q8WV28 O75498 O75499 Q2MD49
Symbols bca
AGM4
BASH
LY57
SLP65
BLNK-S
SLP-65

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (18)

AA Sequence

MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDS      1 - 70
DYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKP     71 - 140
SWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRST    141 - 210
KPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAER    211 - 280
HRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGA    281 - 350
CDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFG    351 - 420
SVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS                                      421 - 456
//

Text Mined References (56)

PMID Year Title