Property Summary

NCBI Gene PubMed Count 27
Grant Count 15
R01 Count 12
Funding $613,955.95
PubMed Score 49.25
PubTator Score 41.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (17)

PMID Text
26191222 Suggest decreased expression of PHLDA1 may play an important role in tumor progression, and may become a new adjunct biomarker in the prognosis in gastric adenocarcinoma.
24954507 Data suggest that high PHLDA1 expression is controlled through an ER-NFkappaB-miR-181 regulatory axis and may contribute to a poor clinical outcome in patients with ER+ breast tumors by enhancing stem-like properties in these tumors.
24270013 A role for PHLDA1 as an apoptosis suppressor in oral cancer cells.
23962557 Data show that downregulation of aurora A kinase by the therapeutic antibody is associated with decreased levels of MYCN protein in cytoplasm, and induced expression of PHLDA1 and P53 proteins.
23719479 PHLDA1 expression is a useful addition in differentiating trichoblastoma and basal cell carcinoma.
23489134 The follicular stem cell marker PHLDA1 (TDAG51) indicates that most basaloid tumors in nevus sebaceus are basal cell carcinomas and not trichoblastomas.
23398472 PHLDA1 differentiates between desmoplastic trichoepithelioma and morpheaform basal cell carcinoma but shows variable staining in microcystic adnexal carcinoma.
22592641 the release of Ca(2+) from endoplasmic reticulum stores mediates epithelial-to-mesenchymal transition in human proximal tubular epithelium via the induction of TDAG51
21807936 crucial negative regulator and effector of Aurora A kinase in breast cancer
21558389 PHLDA1 expression marks the putative epithelial stem cells, downregulates ITGA2 and ITGA6, and contributes to intestinal tumorigenesis
More...

AA Sequence

MRRAPAAERLLELGFPPRCGRQEPPFPLGVTRGWGRWPIQKRREGARPVPFSERSQEDGRGPAARSSGTL      1 - 70
WRIRTRLSLCRDPEPPPPLCLLRVSLLCALRAGGRGSRWGEDGARLLLLPPARAAGNGEAEPSGGPSYAG     71 - 140
RMLESSGCKALKEGVLEKRSDGLLQLWKKKCCILTEEGLLLIPPKQLQHQQQQQQQQQQQQQQQPGQGPA    141 - 210
EPSQPSGPAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQM    211 - 280
VQYKNRQAILAVKSTRQKQQHLVQQQPPSQPQPQPQLQPQPQPQPQPQPQPQSQPQPQPQPKPQPQQLHP    281 - 350
YPHPHPHPHSHPHSHPHPHPHPHPHQIPHPHPQPHSQPHGHRLLRSTSNSA                       351 - 401
//

Text Mined References (28)

PMID Year Title
26191222 2015 Correlation of decreased expression of PHLDA1 protein with malignant phenotype of gastric adenocarcinoma.
24954507 2015 PHLDA1 expression is controlled by an estrogen receptor-NF?B-miR-181 regulatory loop and is essential for formation of ER+ mammospheres.
24270013 2014 Differential susceptibility to hydrogen sulfide-induced apoptosis between PHLDA1-overexpressing oral cancer cell lines and oral keratinocytes: role of PHLDA1 as an apoptosis suppressor.
23962557 2013 Targeting GD2 ganglioside and aurora A kinase as a dual strategy leading to cell death in cultures of human neuroblastoma cells.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23719479 2014 PHLDA1, a follicular stem cell marker, differentiates clear-cell/granular-cell trichoblastoma and clear-cell/granular cell basal cell carcinoma: a case-control study, with first description of granular-cell trichoblastoma.
23489134 2013 Basaloid tumors in nevus sebaceus revisited: the follicular stem cell marker PHLDA1 (TDAG51) indicates that most are basal cell carcinomas and not trichoblastomas.
23398472 2013 The immunohistochemical differential diagnosis of microcystic adnexal carcinoma, desmoplastic trichoepithelioma and morpheaform basal cell carcinoma using BerEP4 and stem cell markers.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22592641 2012 TDAG51 mediates epithelial-to-mesenchymal transition in human proximal tubular epithelium.
More...