Property Summary

NCBI Gene PubMed Count 28
PubMed Score 52.32
PubTator Score 41.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Dermatitis, Allergic Contact 67 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Spiradenoma 7 3.049 1.5
Brooke-Spiegler syndrome 3 3.02 1.5

Expression

Synonym

Accession Q8WV24 A1A4G9 Q15184 Q2TAN2 Q9NZ17
Symbols PHRIP
TDAG51
DT1P1B11

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (18)

AA Sequence

MRRAPAAERLLELGFPPRCGRQEPPFPLGVTRGWGRWPIQKRREGARPVPFSERSQEDGRGPAARSSGTL      1 - 70
WRIRTRLSLCRDPEPPPPLCLLRVSLLCALRAGGRGSRWGEDGARLLLLPPARAAGNGEAEPSGGPSYAG     71 - 140
RMLESSGCKALKEGVLEKRSDGLLQLWKKKCCILTEEGLLLIPPKQLQHQQQQQQQQQQQQQQQPGQGPA    141 - 210
EPSQPSGPAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQM    211 - 280
VQYKNRQAILAVKSTRQKQQHLVQQQPPSQPQPQPQLQPQPQPQPQPQPQPQSQPQPQPQPKPQPQQLHP    281 - 350
YPHPHPHPHSHPHSHPHPHPHPHPHQIPHPHPQPHSQPHGHRLLRSTSNSA                       351 - 401
//

Text Mined References (29)

PMID Year Title