Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (1)

PMID Text
18187620 Knockdown of SFT2 domain containing 1 (SFT2D1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFAICFVCGVFFSILGTGLLWLPGGIKLFAVFYTL      1 - 70
GNLAALASTCFLMGPVKQLKKMFEATRLLATIVMLLCFIFTLCAALWWHKKGLAVLFCILQFLSMTWYSL     71 - 140
SYIPYARDAVIKCCSSLLS                                                       141 - 159
//

Text Mined References (5)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.