Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia -1.800 3.9e-02
acute quadriplegic myopathy 1.008 1.2e-04
Breast cancer 2.000 3.1e-02
group 4 medulloblastoma -1.200 1.7e-05
juvenile dermatomyositis 1.231 1.6e-09
medulloblastoma, large-cell -1.700 1.6e-05
oligodendroglioma 1.200 2.1e-02
osteosarcoma -1.883 1.3e-05
ovarian cancer -1.200 5.3e-04
primary pancreatic ductal adenocarcinoma 1.113 3.8e-03
progressive supranuclear palsy -1.100 7.2e-03
tuberculosis and treatment for 6 months -1.200 5.4e-05

Gene RIF (1)

AA Sequence

MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFAICFVCGVFFSILGTGLLWLPGGIKLFAVFYTL      1 - 70
GNLAALASTCFLMGPVKQLKKMFEATRLLATIVMLLCFIFTLCAALWWHKKGLAVLFCILQFLSMTWYSL     71 - 140
SYIPYARDAVIKCCSSLLS                                                       141 - 159
//

Text Mined References (5)

PMID Year Title