Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.56127690001214E-9
osteosarcoma 7933 1.32016423788698E-5
medulloblastoma, large-cell 6234 1.59132300272348E-5
group 4 medulloblastoma 1875 1.69327617796189E-5
tuberculosis and treatment for 6 months 686 5.36292811625632E-5
acute quadriplegic myopathy 1157 1.17870550809902E-4
primary pancreatic ductal adenocarcinoma 1271 0.00381646002620879
ovarian cancer 8492 0.004126915698601
progressive supranuclear palsy 674 0.00724630979418974
oligodendroglioma 2849 0.021067322127377
Breast cancer 3099 0.0309997540855534
acute myeloid leukemia 785 0.0390847932009602

Expression

  Differential Expression (12)

Synonym

Accession Q8WV19 Q5TI64 Q9UIC7
Symbols pRGR1
C6orf83

Gene

  Ortholog (14)

Gene RIF (1)

PMID Text
18187620 Knockdown of SFT2 domain containing 1 (SFT2D1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFAICFVCGVFFSILGTGLLWLPGGIKLFAVFYTL      1 - 70
GNLAALASTCFLMGPVKQLKKMFEATRLLATIVMLLCFIFTLCAALWWHKKGLAVLFCILQFLSMTWYSL     71 - 140
SYIPYARDAVIKCCSSLLS                                                       141 - 159
//

Text Mined References (5)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.